...

3IT1 MATHEMATICS III (Common to Comp. Engg. & Info. Tech) Evaluation

by user

on
Category: Documents
13

views

Report

Comments

Transcript

3IT1 MATHEMATICS III (Common to Comp. Engg. & Info. Tech) Evaluation
3IT1 MATHEMATICS III (Common to Comp. Engg. & Info. Tech)
Class: III Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3, Tutorial: 1
Units
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
I
Introduction: Engineering application of optimization, Statement and classification
of optimization problem, single variable and multivariable optimization with and
without constraints.
II
Linear Programming: Formulation of Linear Programming problem, Graphical
Approach, General Linear Programming problem, Simple Method. Duality in Linear
Programming and Transportation Problems.
Project Scheduling: Project Scheduling by PERT and CPM Network Analysis.
III
IV
Sequencing Theory: General Sequencing problem n-jobs through 2 machines & 3
machines and 2-jobs through m machines.
LAPLACE TRANSFORM: Laplace transform with its simple properties. Inverse
Laplace transform, convolution theorem (without proof), solution of ordinary
differential equation with constant coefficient, solution of partial differential
equation having constant coefficient with special reference to diffusion, Heat
conduction and wave equation. Boundary value problems
NUMERICAL ANALYSIS: Difference operators forward, backward, control, shift
and average operators and relation between them. Newton’s and Gauss forward and
backward interpolation formula for equal interval, Sterling & formula for control
difference. Lagranges Interpolation formula. Inverse Interpolation.
V
Numerical differentiation by Newtons, Gauss and Sterling’s formula. Numerical
Integration by Simpson’s one third and there eight rule. Numerical Integration of
ordinary differential equation of first order by Picards method, Euler’s and modified
Euler’s method, Milure’s method and Runga Kutta fourth order method. Solution of
difference equation.
Text/References:
1. Operation Research By Kanti Swaroop, P. K. Gupta & Manmohan, Sultan chand & sons
2. Integral Transform By Dr. R.K. Gupta, A.R. Vashishtha, Krishna Prakashan Mandir
Meerut
3. Calculus of Finite Differences & Numerical Analysis By Dr. Gupta & Malik Krishna
Prakashan Mandir Meerut
4. Engineering Mathematics III By Jain and Rawat, CBC
5. Engineering Mathematics III By Prof. K.C. Sarangi and others, Genius publications
1
3IT2 ELECTRONIC DEVICES & CIRCUITS (Common to Comp. Engg. & Info. Tech)
Class: III Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
Contents of the subject
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
I
Mobility and conductivity, charge densities in a semiconductor, Fermi Dirac
distribution, carrier concentrations and fermi levels in semiconductor, Generation
and recombination of charges, diffusion and continuity equation, Mass action Law,
Hall effect. Junction diodes, Diode as a ckt. element, load line concept, clipping and
clamping circuits, Voltage multipliers.
II
Transistor characteristics, Current components, Current gains: alpha and beta.
Operating point. Hybrid model, h-parameter equivalent circuits. CE, CB and CC
configuration. DC and AC analysis of CE,CC and CB amplifiers. Ebers-Moll
model. Biasing & stabilization techniques. Thermal runaway, Thermal stability.
III
SMALL SIGNAL AMPLIFIERS AT LOW FREQUENCY : Analysis of BJT and
FET, RC coupled amplifiers. Frequency response, midband gain, gains at low and
high frequency. Miller’s Theorem. Cascading Transistor amplifiers, Emitter
follower. JFET, MOSFET, Equivalent circuits and biasing of JFET's & MOSFET’s.
Low frequency CS and CD JFET amplifiers. FET as a voltage variable resistor.
Source follower.
IV
FEEDBACK AMPLIFIERS : Classification, Feedback concept, Transfer gain with
feedback, General characteristics of negative feedback amplifiers. Analysis of
voltage-series, voltage-shunt, current- series and current-shunt feedback amplifier.
Stability criterion.
V
OSCILLATORS : Classification. Criterion for oscillation. Tuned collector, Hartley,
Colpitts, RC Phase shift, Wien bridge and crystal oscillators, Astable, monostable
and bistable multivibrators. Schmitt trigger.
Text/References:
1. Electronic devices & circuits theory By R.L. Boylestad, Louis Nashelsky ,Pearson
education
2. Integrated Electronics By Millman Halkias, T.M.H
3. Electronic devices & circuits By David Bell, Oxford Publications
4. Grob’s Basic Electronics By Schultz, T.M.H.
2
3IT3 DATA STRUCTURES & ALGORITHMS (Common to Comp. Engg. & Info.
Tech)
Class: III Sem. B.Tech.
Evaluation
Branch: I.T.
Schedule per Week
Lectures: 3
Units
I
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
Definition & characteristics of algorithms, structures. Difficulties in estimating
exact execution time of algorithms. Concept of complexity of program.
Asymptotic notations: Big-Oh, theta, Omega- Definitions and examples,
Determination of time and space complexity of simple algorithms without
recursion. Representing a function in asymptotic notations viz 5n2-6n=ș(n2)
Arrays: Array as storage element, Row major & column major form of arrays,
computation of address of elements of n dimensional array.
Arrays as storage elements for representing polynomial of one or more degrees
for addition & multiplication, sparse matrices for transposing & multiplication,
stack, queue, dequeue, circular queue for insertion and deletion with condition
for over and underflow, transposition of sparse matrices with algorithms of
varying complexity (Includes algorithms for operations as mentioned).
II
Evaluation of Expression: Concept of precedence and associativity in
expressions, difficulties in dealing with infix expressions, Resolving precedence
of operators and association of operands, postfix & prefix expressions,
conversion of expression from one form to other form using stack (with &
without parenthesis), Evaluation of expression in infix, postfix & prefix forms
using stack. Recursion.
Linear linked lists: singly, doubly and circularly connected linear linked listsinsertion, deletion at/ from beginning and any point in ordered or unordered lists.
Comparison of arrays and linked lists as data structures.
III
Linked implementation of stack, queue and dequeue. Algorithms for of insertion,
deletion and traversal of stack, queue, dequeue implemented using linked
structures. Polynomial representation using linked lists for addition, Concepts of
Head Node in linked lists.
Searching: Sequential and binary search
IV
Non-Linear Structures: Trees definition, characteristics concept of child, sibling,
parent child relationship etc, binary tree: different types of binary trees based on
distribution of nodes, binary tree (threaded and unthreaded) as data structure,
3
insertion, deletion and traversal of binary trees, constructing binary tree from
traversal results. Threaded binary Tree. Time complexity of insertion, deletion
and traversal in threaded and ordinary binary trees. AVL tree: Concept of
balanced trees, balance factor in AVL trees, insertion into and deletion from
AVL tree, balancing AVL tree after insertion and deletion. Application of trees
for representation of sets.
Graphs: Definition, Relation between tree & graph, directed and undirected
graph, representation of graphs using adjacency matrix and list. Depth first and
breadth first traversal of graphs, finding connected components and spanning
tree. Single source single destination shortest path algorithms.
V
Sorting: Insertion, quick, heap, topological and bubble sorting algorithms for
different characteristics of input data. Comparison of sorting algorithms in term
of time complexity.
NOTE:
1. Algorithm for any operation mentioned with a data structure or required to
implement the particular data structure is included in the curriculum.
Text/References:
1. An introduction to data structures with applications By Jean-Paul Tremblay, P. G.
Sorenson, TMH
2. Data Structures in C/C++, Horowitz, Sawhney
3. Data Structures in C/C++, Tanenbaum, PHI
4
3IT4 OBJECT ORIENTED PROGRAMMING (Common to Comp. Engg. & Info. Tech)
Class: III Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
I
II
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
Introduction: Review of structures in C, accessing members of structures using
structure variables, pointer to structures, passing structures to functions, structures as
user defined data types.
Introduction to programming paradigms- (Process oriented and Object oriented).
Concept of object, class, objects as variables of class data type, difference in
structures and class in terms of access to members, private and public Basics of
C++: Structure of C++ programs, introduction to defining member functions within
and outside a class, keyword using, declaring class, creating objects, constructors &
destructor functions, Initializing member values with and without use of
constructors, simple programs to access & manipulate data members, cin and cout
functions. Dangers of returning reference to a private data member, constant objects
and members function, composition of classes, friend functions and classes, using
this pointer, creating and destroying objects dynamically using new and delete
operators.
Static class members, container classes and iterators, proxy classes.
members of a class, data & function members. Characteristics of OOP- Data hiding,
Encapsulation, data security.
III
Operator overloading: Fundamentals, Restrictions, operator functions as class
members v/s as friend functions. Overloading stream function, binary operators and
unary operators. Converting between types.
IV
Inheritance: Base classes and derived classes, protected members, relationship
between base class and derived classes, constructors and destructors in derived
classes, public, private and protected inheritance, relationship among objects in an
inheritance hierarchy, abstract classes, virtual functions and dynamic binding, virtual
destructors.
V
Multiple inheritance, virtual base classes, pointers to classes and class members,
multiple class members. Templates, exception handling.
Text/References:
5
1.
2.
3.
4.
How to Program C++, Dietel, Pearson
Mastering C++ By K.R.Venugopal, TMH
Object Oriented Programming in C++ By Robert Lafore, Pearson
Object Oriented Design & Modelling, Rambaugh, PHI
6
3IT5 DIGITAL ELECTRONICS (Common to Comp. Engg. & Info. Tech)
Class: III Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
I
NUMBER SYSTEMS, BASIC LOGIC GATES & BOOLEAN ALGEBRA: Binary
Arithmetic & Radix representation of different numbers. Sign & magnitude
representation, Fixed point representation, complement notation, various codes &
arithmetic in different codes & their inter conversion. Features of logic algebra,
postulates of Boolean algebra. Theorems of Boolean algebra. Boolean function.
Derived logic gates: Exclusive-OR, NAND, NOR gates, their block diagrams and
truth tables. Logic diagrams from Boolean expressions and vica-versa. Converting
logic diagrams to universal logic. Positive, negative and mixed logic. Logic gate
conversion.
II
DIGITAL LOGIC GATE CHARACTERISTICS: TTL logic gate characteristics.
Theory & operation of TTL NAND gate circuitry. Open collector TTL. Three state
output logic. TTL subfamilies. MOS & CMOS logic families. Realization of logic
gates in RTL, DTL, ECL, C-MOS & MOSFET. Interfacing logic families to one
another.
III
MINIMIZATION TECHNIQUES: Minterm, Maxterm, Karnaugh Map, K map upto
4 variables. Simplification of logic functions with K-map, conversion of truth
tables in POS and SOP form. Incomplete specified functions. Variable mapping.
Quinn-Mc Klusky minimization techniques.
IV
COMBINATIONAL SYSTEMS: Combinational logic circuit design, half and full
adder, subtractor. Binary serial and parallel adders. BCD adder. Binary multiplier.
Decoder: Binary to Gray decoder, BCD to decimal, BCD to 7-segment decoder.
Multiplexer, demultiplexer, encoder. Octal to binary, BCD to excess-3 encoder.
Diode switching matrix. Design of logic circuits by multiplexers, encoders, decoders
and demultiplexers.
V
SEQUENTIAL SYSTEMS: Latches, flip-flops, R-S, D, J-K, Master Slave flip
flops. Conversions of flip-flops. Counters : Asynchronous (ripple), synchronous
andsynchronous decade counter, Modulus counter, skipping state counter, counter
design. Ring counter. Counter applications. Registers: buffer register, shift register.
7
Text/References:
1.
2.
3.
4.
5.
Digital integrated electronics, By Herbert Taub, Donald L. Schilling
Modern Digital Electronics By R.P. Jain, TMH
Digital Logic and Computer Design By M. Morris Mano, PHI
Fundamentals of Digital circuits By A. Anand kumar, PHI
Digital circuit design By S. Salivahanan, Sarivazhagan, Vikas publications
8
3IT6.1 OPTICAL COMMUNICATION (Common to Comp. Engg. & Info. Tech)
Class: III Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
I
OPTICAL FIBERS - Basic optical laws and definitions, Principles of light
propagation in fibers, Ray theory, Optical fiber modes and configurations, Step
index and graded index fibers, Monomode and multimode fibers, Fiber materials,
fiber fabrication, Fiber optic cables. Attenuation, signal distortion in optical fibers,
Dispersion-intra modal & inter modal, Dispersion shifted and flattened fiber.
II
OPTICAL SOURCES - LED’s- Structure, Materials, Characteristics, Modulation,
Power & efficiency, Laser Diodes - Basic concept, Hetro Structure, properties and
modulation.
III
OPTICAL DETECTORS - PIN and Avalanche photo diodes, photo detector noise,
detector response time, Avalanche multiplication noise. Photo diode materials.
Fundamental of Optical Receiver Operation.
IV
OPTICAL FIBER COMMUNICATION SYSTEMS- Source to fiber coupling, fiber
to fiber joints, fiber splicing, fiber connectors. Principle components. Link design
calculation, Applications, Wavelength division multiplexing.
V
OPTICAL FIBER MEASUREMENTS: Measurements of Fiber attenuation,
Dispersion, refractive index profile, Numerical aperture & diameter.
Text/References:
1.
2.
3.
4.
Fiber optics communication By Harold Kolimbiris, Pearson education
Optical fiber communication By John M.Senior, Pearson education
Fiber Optics and Optoelectronics By R.P. Khare, Oxford Publication
Principles of Optical Fiber By Gerd Keiser, TMH
9
3IT6.2 FUNDAMENTALS OF LINUX SHELL PROGRAMMING
(Common to Comp. Engg. & Info. Tech)
Class: III Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
I
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
Introduction: Logging in, changing password (passwd command only), man, xman,
info commands to access on line help. Simple commands like ls, cp, mv, grep, head,
tail, sort, uniq, diff, echo, date, which, whereis, whatis, who, finger w (option and
variations included).
Directory commands, access permissions, changing access permissions for files and
directories, hard & symbolic links. Environment and path setting.
II
vi editor: Creating and editing files, features of vi, insertion deletion, searching,
substitution operations, yank, put, delete commands, reading & writing files, exrc
file for setting parameters, advance editing techniques. vim(improved vi).
Programming utilities: Compiling & linking C, C++ programs, make utility,
debugging C programs using gdb, system call.
III
IV
V
Introduction to X-window system: x-window as client/ server system, concept of
window manager, remote computing & local displays, xinitrc file, customize X work
environment and applications, customizing the fvwm window manager.
Shell: Meaning and purpose of shell, Introduction to types of shell. The command
line, standard input and standard output, redirection, pipes, filters special characters
for searching files and pathnames.
Bourne Again SHell: shell script-writing and executing, command separation &
grouping, redirection, directory stack manipulation, processes, parameters &
variables, keyword variables.
Shell Programming: Control structures, the Here document, expanding NULL or
USET variables, Builtins, functions, history, aliases, job control, filename
substitution. source code management- RCS and CVS. awk utility.
Text/References:
1. A practical Guide to Linux, Sobell, Pearson.
2. A Practical Guide to Linux Commands, Editors, and Shell Programming, Sobell,
Pearson.
3. A Practical Guide to Fedora and Red Hat Enterprise Linux, Sobell, 5e, Pearson
10
3IT6.3 MANAGEMENT INFORMATION SYSTEM
(Common to Comp. Engg. & Info. Tech)
Class: III Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
I
Introduction to MIS: concept, Definition, role, Impact and effectiveness of MIS. Ebusiness enterprise: Introduction, E-business, E-commerce, E-communication, Ecollaboration. Information Security Challenges: Security Threats controlling and
management.
II
Basic of Management Information System: Decision Making, Information and
knowledge, OO- Technology and MIS, Business process Re-engineering.
III
IV
V
Application of Management Information system: Application in manufacturing sector
using for personal management, financial management, Production Management,
Material Management, Marketing Management Application in Service Sector.
Enterprise Resource Planning (ERP): EMS, ERP, Benefits implementation, EMS & MIS.
Case Studies: Application of SAP technologies in manufacturing sector
Database and client server architecture, Data Warehouse: architecture to
implementation, E-business Technology: Electronic payment systems, Web enabled
business management, MIS in web environment.
Text/References:
1. Management Information Systems By W.S. Javadekar, T.M.H.
2. Management Information Systems By Laudon & Laudon, T.M.H.
11
3IT7 PROGRAMMING IN C++ (Common to Comp. Engg. & Info. Tech)
Class: III Sem. B.Tech.
Branch: I.T.
Schedule per Week
Practical Hrs.: 3
S. No.
Evaluation
Examination Time = Three (4) Hours
Maximum Marks = 100
[Sessional/Mid-term (60) & End-term (40)]
List of Experiments
1
To write a simple program for understanding of C++ program structure without any
CLASS declaration. Program may be based on simple input output, understanding of
keyword using.
2
Write a C++ program to demonstrate concept of declaration of class with public &
private member, constructors, object creation using constructors, access restrictions,
defining member functions within and outside a class. Scope resolution operators,
accessing an object’s data members and functions through different type of object
handle name of object, reference to object, pointer to object, assigning class objects
to each other.
3
Program involving multiple classes (without inheritance) to accomplish a task.
Demonstrate composition of class.
4
Demonstration Friend function friend classes and this pointer.
5
Demonstration dynamic memory management using new & delete & static class
members.
6
Demonstration of restrictions an operator overloading, operator functions as member
function and/ or friend function, overloading stream insertion and stream extraction,
operators, overloading operators etc.
7
Demonstrator use of protected members, public & private protected classes, multilevel inheritance etc.
8
Demonstrating multiple inheritance, virtual functions, virtual base classes, abstract
classes
12
3IT8 DATA STRUCTURES LAB (Common to Comp. Engg. & Info. Tech)
Class: III Sem. B.Tech.
Branch: I.T.
Schedule per Week
Practical Hrs : 3
S. No.
Evaluation
Examination Time = Three (4) Hours
Maximum Marks = 100
[Sessional/Mid-term (60) & End-term (40)]
List of Experiments
1
Write a simple C program on a 32 bit compiler to understand the concept of array
storage, size of a word. The program shall be written illustrating the concept of row
major and column major storage. Find the address of element and verify it with the
theoretical value. Program may be written for arrays upto 4-dimensions.
2
Simulate a stack, queue, circular queue and dequeue using a one dimensional array
as storage element. The program should implement the basic addition, deletion and
traversal operations.
3
Represent a 2-variable polynomial using array. Use this representation to implement
addition of polynomials.
4
Represent a sparse matrix using array. Implement addition and transposition
operations using the representation.
5
Implement singly, doubly and circularly connected linked lists illustrating operations
like addition at different locations, deletion from specified locations and traversal.
6
Repeat exercises 2, 3 & 4 with linked structures.
7
Implementation of binary tree with operations like addition, deletion, traversal.
8
Depth first and breadth first traversal of graphs represented using adjacency matrix
and list.
9
Implementation of binary search in arrays and on linked Binary Search Tree.
10
Implementation of insertion, quick, heap, topological and bubble sorting algorithms.
13
3IT9 ANALOG ELECTRONICS LAB (Common to Comp. Engg. & Info. Tech)
Class: III Sem. B.Tech.
Branch: I.T.
Schedule per Week
Practical Hrs : 3
S. No.
Evaluation
Examination Time = Three (4) Hours
Maximum Marks = 100
[Sessional/Mid-term (60) & End-term (40)]
List of Experiments
1
Plot V-I characteristic of P-N junction diode & calculate cut-in voltage, reverse
Saturation current and static & dynamic resistances.
2
Plot V-I characteristic of zener diode and study of zener diode as voltage regulator.
Observe the effect of load changes and determine load limits of the voltage
regulator.
3
Plot frequency response curve for single stage amplifier and to determine gain
bandwidth product.
4
Plot drain current - drain voltage and drain current – gate bias characteristics of field
effect transistor and measure of Idss & Vp
5
Application of Diode as clipper & clamper
6
Plot gain- frequency characteristic of two stages RC coupled amplifier & calculate
its bandwidth and compare it with theoretical value.
7
Plot gain- frequency characteristic of emitter follower & find out its input and output
resistances.
8
Plot input and output characteristics of BJT in CB, CC and CE configurations. Find
their h-parameters.
9
Plot gain-frequency characteristics of BJT amplifier with and without negative
feedback in the emitter circuit and determine bandwidths, gain bandwidth products
and gains at 1kHz with and without negative feedback.
10
Plot and study the characteristics of small signal amplifier using FET.
11
Study Wein bridge oscillator and observe the effect of variation in R & C on
oscillator frequency
12
Study transistor phase shift oscillator and observe the effect of variation in R & C on
oscillator frequency and compare with theoretical value.
13
To plot the characteristics of UJT and UJT as relaxation.
14
To plot the characteristics of MOSFET and CMOS.
14
3IT10 DIGITAL ELECTRONICS LAB (Common to Comp. Engg. & Info. Tech)
Class: III Sem. B.Tech.
Branch: I.T.
Schedule per Week
Practical Hrs : 3
S. No.
Evaluation
Examination Time = Three (4) Hours
Maximum Marks = 50
[Sessional/Mid-term (30) & End-term (20)]
List of Experiments
1
To verify the truth tables of basic logic gates: AND, OR, NOR, NAND, NOR. Also
to verify the truth table of Ex-OR, Ex-NOR (For 2, 3, & 4 inputs using gates with 2,
3, & 4 inputs).
2
To verify the truth table of OR, AND, NOR, Ex-OR, Ex-NOR realized using NAND
& NOR gates.
3
To realize an SOP and POS expression.
4
To realize Half adder/ Subtractor & Full Adder/ Subtractor using NAND & NOR
gates and to verify their truth tables.
5
To realize a 4-bit ripple adder/ Subtractor using basic Half adder/ Subtractor & basic
Full Adder/ Subtractor.
6
To verify the truth table of 4-to-1 multiplexer and 1-to-4 demultiplexer. Realize the
multiplexer using basic gates only. Also to construct and 8-to-1 multiplexer and 1to-8 demultiplexer using blocks of 4-to-1 multiplexer and 1-to-4 demultiplexer
7
Design & Realize a combinational circuit that will accept a 2421 BCD code and
drive a TIL -312 seven-segment display.
8
Using basic logic gates, realize the R-S, J-K and D-flip flops with and without clock
signal and verify their truth table
9
Construct a divide by 2,4 & 8 asynchronous counter. Construct a 4-bit binary
counter and ring counter for a particular output pattern using D flip flop.
10
Perform input/output operations on parallel in/Parallel out and Serial in/Serial out
registers using clock. Also exercise loading only one of multiple values into the
register using multiplexer.
Note: As far as possible, the experiments shall be performed on bread board.
However, experiment Nos. 1-4 are to be performed on bread board only.
15
4IT1 MICROPROCESSOR AND INTERFACES (Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
I
Introduction to Microprocessors, microcontroller; 8085 Microprocessor
Architecture, pin description, Bus concept and organization; concept of multiplexing
and demultiplexing of buses; concept of static and dynamic RAM, type of ROM,
memory map.
II
Software architecture registers and signals, Classification of instruction, Instruction
set, addressing modes, Assembly Language Programming and Debugging,
Programming Technique, instruction Format and timing.
III
Advance Assembly Language Programming, Counter and time delay; types of
Interrupt and their uses, RST instructions and their uses, 8259 programmable
interrupt controller; Macros, subroutine; Stack- implementation and uses with
examples; Memory interfacing.
IV
8085 Microprocessor interfacing:, 8255 Programmable Peripheral Interface, 8254
programmable interval timer, interfacing of Input/output device, 8279 Key
board/Display interface.
V
Microprocessor Application: Interfacing scanned multiplexed display and liquid
crystal display, Interfacing and Matrix Keyboard, MPU Design; USART 8251,
RS232C and RS422A, Parallel interface- Centronics and IEEE 488 .
Text/References:
1. Microprocessor architecture, programming, and applications with the 8085 By
Ramesh S. Gaonkar
2. Introduction to Microprocessor By Aditya P. Mathur, TMH
3. Microprocessor & Interfaceing By Douglas V. Hall,TMH
4. Microprocessor & Peripheral By A.K.Ray, K.M. Bhurchandi,TMH
16
4IT2 PRINCIPLES OF PROGRAMMING LANGUAGES
(Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
I
Programming Language: Definition, History, Features. Issues in Language Design:
Structure and Operation of computer, Programming Paradigms. Efficiency,
Regularity. Issues in Language Translation: Syntax and Semantics.
II
Specifications and Implementation of Elementary and Structured Data Types. Type
equivalence, checking and conversion. Vectors and Arrays, Lists, Structures, Sets,
Files.
III
Sequence control with Expressions, Conditional Statements, Loops, Exception
handling. Subprogram definition and activation, simple and recursive subprogram,
subprogram environment.
IV
Scope – Static and Dynamic, Block structures, Local Data and Shared Data,
Parameters and Parameter Transmission. Local and Common Environments, Tasks
and Shared Data.
V
Abstract Data type, information hiding, encapsulation, type definition. Static and
Stack-Based Storage management. Fixed and Variable size heap storage
management, Garbage Collection.
Text/References:
1. Programming languages: design and implementation, Terrence W. Pratt.
2. Programming languages: concepts and constructs, Ravi Sethi, ISBN 9780201590654.
3. Programming Language Pragmatics, Scott, ELSEVIER
17
4IT3 DISCRETE MATHEMATICAL STRUCTURES
(Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3, Tutorial:1
Units
I
II
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
Language of Logic: Proposition, Compound Proposition, Conjunction, Disjunction,
Implication, Converse, Inverse & Contrpositive, Biconditional Statements,
tautology, Contradiction & Contingency, Logical Equivalences, Quantifiers,
Arguments.
Proof Methods: Vacuous, Trivial, Direct, Indirect by Contrapositive and
Contradiction, Constructive & Non-constructive proof, Counterexample. The
Division Algorithm, Divisibilty Properties (Prime Numbers & Composite Numbers),
Principle of Mathematical Induction, The Second Principle of Mathematical
Induction, Fundamental Theorem of Arithmetic.
Algorithm Correctness: Partial Correctness, Loop Invariant. Testing the partial
correctness of linear & binary search, bubble & selection sorting.
III
Graph Theory: Graphs – Directed, Undirected, Simple,. Adjacency & Incidence,
Degre of Vertex, Subgraph, Complete graph, Cycle & Wheel Graph, Bipartite &
Complete Bipartite Graph, Weighed Graph, Union of Simple Graphs. Complete
Graphs. Isomorphic Graphs, Path, Cycles & Circuits Euclerian & Hamiltonian
Graphs.
Planar Graph: Kuratowski’s Two Graphs, Euler’s Formula, Kuratowski’s Theorem.
Trees: Spanning trees- Kruskal’s Algo, Finding Spanning Tree using Depth First
Search, Breadth First Search, Complexity of Graph, Minimal Spanning Tree.
Sets: Definition and types, Set operations, Partition of set, Cardinality (InclusionExclusion & Addition Principles), Recursive definition of set.
IV
V
Functions: Concept, Some Special Functions (Polynomial, Exponential &
Logarithmic, Absolute Value, Floor & Ceiling, Mod & Div Functions), Properties of
Functions, Cardinality of Infinite Set, Countable & Uncountable Sets, The
Pigeonhole & Generalized Pigeonhole Principles, Composition of Functions.
Relations: Boolean Matrices, Binary Relation, Adjacency Matrix of Relation,
Properties of Relations, Operations on Relations, The Connectivity Relations,
Transitive Closure-Warshall’s Algorithm, Equivalence relations- Congruence
Relations, Equivalence Class, Number of Partitions of a Finite Set, Partial & Total
Orderings.
Text/References:
18
1. Discrete Mathematics with Applications, Koshy, ELSEVIER
2. Discrete Mathematical Structures By Lipschutz & Lipson, TMH
3. Discrete Mathematical Structures, Kolman et.al, Pearson
19
4IT4 STATISTICS & PROBABILITY THEORY (Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3, Tutorial:1
Units
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
Introduction & Discrete random variables
I
Sample space, events, algebra of events, Bernoulli’s trials, Probability & Baye’s
theorem. Random variable & their event space, probability generating function,
expectations, moments, computations of mean time to failure, Bernoulli & Poisson
processes.
Discrete & continuous distributions
II
III
Probability distribution & probability densities: Binomial, Poisson, normal
rectangular and exponential distribution & their PDF’s, moments and MGF’s for
above distributions.
Correlation & Regression Correlation & regression: Linear regression, Rank
correlation, Method of least squares Fitting of straight lines & second degree
parabola. Normal regression and correlation analysis.
Queuing Theory
IV
V
Pure birth, pure death and birth-death processes. Mathematical models for M/M/1,
M/M/N, M/M/S and M/M/S/N queues.
Discrete Parameter mark on chains:
M/G/1 Queuing model, Discrete parameter birth-death process.
Text/References:
1. Probability, Statistics & Random Process By T. Veerajan, TMH
2. Fundamental of Mathematical Statistics By S.C.Gupta and V.K. Kapoor,
Sultanchand & sons.
3. Statistics and Probability Theory By Jain & Rawat ,CBC
4. Statistics and Probability Theory By Schaum’s, T.M.H.
20
4IT5 SOFTWARE ENGINEERING (Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
I
II
III
IV
V
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
System Analysis: Characteristics, Problems in system Development, System Level
project Planning, System Development Life cycle (SDLC), computer system
engineering & system analysis, modeling the architecture, system specification.
Software & its characteristics: Software Development, Process Model, Prescriptive
model, The water fall model, Incremental Process Modes, Evolutionary process
model, specialized process model.
Requirement Analysis: Requirement analysis tasks, Analysis principles, Software
prototyping and specification data dictionary finite state machine (FSM) models.
Structured Analysis: Data and control flow diagrams, control and process
specification behavioral modeling, extension for data intensive applications.
Software Design: Design fundamentals, Effective modular design: Data architectural
and procedural design, design documentation, coding – Programming style, Program
quality, quantifying program quality, complete programming example
Object Oriented Analysis: Object oriented Analysis Modeling, Data modeling
Object Oriented Design: OOD concepts and methods class and object definitions,
refining operations, Class and object relationships, object modularization,
Introduction to Unified Modeling Language
Text/References:
1. Software Engineering By Roger S. Pressman, TMH
2. Software Engineering Fundamental By Ali Behforooz, Frederick J Hudson, Oxford
University Press
21
4IT6.1 ANALOG & DIGITAL COMMUNICATION
(Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
I
AMPLITUDE MODULATION: Frequency translation, Recovery of base band
signal, Spectrum & power relations in AM systems. Methods of generation &
demodulation of AM-DSB, AM-DSB/SC and AM-SSB signals. Modulation &
detector circuits for AM systems. AM transmitters & receivers.
II
FREQUENCY MODULATION : Phase & freq. modulation & their relationship,
Spectrum & band width of a sinusoidally modulated FM signal, phasor diagram,
Narrow band & wide band FM. Generation & demodulation of FM signals. FM
transmitters & receivers. Comparison of AM, FM & PM. Pre emphasis & deemphasis. Threshold in FM, PLL demodulator.
III
PCM & DELTA MODULATION SYSTEMS : Uniform and Non-uniform
quantization. PCM and delta modulation, Signal to quantization noise ratio in PCM
and delta modulation. DPCM, ADM, T1 Carrier System, Matched filter detection.
Error probability in PCM system.
IV
V
BASE BAND TRANSMISSION: Line coding(RZ,NRZ): Polar, Bipolar,
Manchester, AMI. Inter symbol interference, Pulse shaping, Nyquist criterion,
Raised cosine spectrum.
PULSE ANALOG MODULATION: Practical aspects of sampling: Natural and flat
top sampling. PAM, PWM, PPM modulation and demodulation methods, PAMTDM.
DIGITAL MODULATION TECHNIQUES : Geometric interpretation of signals,
Orthogonalization. ASK, BPSK, BFSK, QPSK, MSK modulation techniques and
Coherent detection of these techniques. Calculation of error probabilities.
Text/References:
1.
2.
3.
4.
5.
6.
Principles of communication systems By Taub Schilling, T.M.H.
Fundamentals of communication systems By Proakis & Salehi, Pearson education
Analog & Digital Communication By Simon Haykin, John Wiley
Communication Systems (Analog and Digital) By R.P. Singh, S.D. Sapre, T.M.H.
Modern Digital & Analog Communication By B.P. Lathi, Oxford Publications
Digital & Analog Communication Systems By K.S. Shanmugam, John Wiley
22
4IT6.2 LINEAR INTEGRATED CIRCUITS (Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
I
OPERATIONAL AMPLIFIERS: Basic differential amplifier analysis, Single ended
and double ended configurations ,Op-amp configurations with feedback, Op-amp
parameters, Inverting and Non- Inverting configuration, Comparators, Adder.
II
OPERATIONAL AMPLIFIER APPLICATIONS: Integrator, Differentiator,
Voltage to frequency & Frequency to voltage converters. Oscillators: Phase shift,
Wien bridge, Quadrature, square wave, triangular wave, sawtooth oscillators.
Voltage controlled oscillators.
III
ACTIVE FILTERS: Low pass, high pass, band pass and band reject filters,All pass
filter, Switched capacitor filter, Butterworth filter design, Chebyshev Filter design.
IV
PHASE-LOCKED LOOPS: Operating Principles of PLL, Linear Model of PLL,
Lock range, Capture range, Applications of PLL as FM detector, FSK demodulator,
AM detector, frequency translator, phase shifter, tracking filter, signal synchronizer
and frequency synthesizer, Building blocks of PLL, LM 565 PLL.
V
LINEAR IC’s: Four quadrant multiplier & its applications, Basic blocks of linear IC
voltage regulators, Three terminal voltage regulators, Positive and negative voltage
regulators. The 555 timer as astable and monostable multivibrators. Zero crossing
detector, Schmitt trigger.
Text/References:
1. Op-amp and Linear integrated circuits By Gayakwad, Pearson education
2. Operational amplifier and Linear integrated circuits By Coughlin & Driscoll,
Pearson education
3. Integrated circuits By K.R. Botkar, Khanna Publishers
23
4IT6.3 LOGIC AND FUNCTIONAL PROGRAMMING
(Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Branch: I.T.
Schedule per Week
Lectures: 3
Units
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Contents of the subject
I
PROPOSITIONS AND PREDICATES: Evaluation of constant propositions,
Evaluation of proposition in a state. Precedence rules for operators, Tautologies,
Propositions a sets of states and Transforming English to propositional form.
Introduction to first-order predicate logic, Quantifiers and Reasoning.
II
LOGIC PROGRAMMING USING PROLOG: Constants, Goals and Clauses, Facts,
Rules, Semantics, Rules and Conjunction, Rules and Disjunction, Search strategy,
Queries.
III
ADVANCED LOGIC PROGRAMMING USING PROLOG: Unification,
Recursion, Lists, Cut operator, and Sorting. Data structures, Text strings, Searching
state space, Operators and their precedence, and Parsing in Prolog.
IV
FUNCTIONAL PROGRAMMING: Introduction to lambda calculus-Syntax and
semantics, Computability and correctness, Lazy and Eager Evaluation Strategies,
comparison of functional and imperative languages.
V
FUNCTIONAL PROGRAMMING USING HASKELL: Introduction, lists, Userdefined data types, type classes, and arrays in Haskell. Input/Ouput in Haskell - type
classes IO and Monad, Simple applications/programs in Haskell.
Text/References:
1. Logical foundations of functional programming By Gerard Huet, AddisonWesley Longman Publishing Co.
2. Mathematical Logic for Computer Science By M. Ben- Ari, Prentice Hall
3. The Essence of Logic By John Kelly, Prentice-Hall of India
24
4IT7 MICROPROCESSOR LAB (Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Branch: I.T.
Schedule per Week
Practical Hrs.: 3
S. No.
Evaluation
Examination Time = Three (4) Hours
Maximum Marks = 50
[Sessional/Mid-term (30) & End-term (20)]
List of Experiments
4
Add the contents of memory locations XX00 &XX01 & place the result in memory
location XX02.
Add the 16 bit numbers stored in memory location & store the result in another
memory location.
Transfer a block of data from memory location XX00 to another memory location
XX00 in forward & reverse order.
Write a program to Swap two blocks of data stored in memory.
5
Write a program to find the square of a number.
6
7
Write a main program & a conversion subroutine to convert Binary to its equivalent
BCD.
Write a program to find largest & smallest number from a given array.
8
Write a program to Sort an array in ascending & descending order.
9
Write a program to multiply two 8 bit numbers whose result is 16 bit.
10
Write a program of division of two 8 bit numbers.
11
Generate square wave from SOD pin of 8085 & observe on CRO.
12
Write a program to perform traffic light control operation.
13
Write a program to control the speed of a motor.
1
2
3
25
4IT8 COMMUNICATION LAB (Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Branch: I.T.
Schedule per Week
Practical Hrs : 3
S. No.
Evaluation
Examination Time = Three (4) Hours
Maximum Marks = 50
[Sessional/Mid-term (30) & End-term (20)]
List of Experiments
Harmonic analysis of a square wave of modulated waveform
1
2
Observe the amplitude modulated waveform and measures modulation index.
Demodulation of the AM signal
To modulate a high frequency carrier with sinusoidal signal to obtain FM signal.
Demodulation of the FM signal
To observe the following in a transmission line demonstrator kit :
3
i.
The propagation of pulse in non-reflecting Transmission line.
ii.
The effect of losses in Transmission line.
iii.
The resonance characteristics of al half wavelength long x-mission line.
4
To study and observe the operation of a super heterodyne receiver
5
To modulate a pulse carrier with sinusoidal signal to obtain PWM signal and
demodulate it.
6
To modulate a pulse carrier with sinusoidal signal to obtain PPM signal and
demodulate it.
7
To observe pulse amplitude modulated waveform and its demodulation.
8
To observe the operation of a PCM encoder and decoder. To consider reason for
using digital signal x-missions of analog signals.
9
Produce ASK signals, with and without carrier suppression. Examine the different
processes required for demodulation in the two cases
10
To observe the FSK wave forms and demodulate the FSK signals based on the
properties of (a) tuned circuits (b) on PI.L.
11
To study & observe the amplitude response of automatic gain controller (AGC ).
26
4IT9 ADVANCE OBJECT ORIENTED PROGRAMMING
(Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Branch: I.T.
Schedule per Week
Practical Hrs : 3
S. No.
Evaluation
Examination Time = Three (4) Hours
Maximum Marks = 100
[Sessional/Mid-term (60) & End-term (40)]
List of Experiments
1.
Write a C++ Object Oriented Code for Huffman Coding & Decoding. The code
must have implementation of Binary tree, binary Search, Scanning of Input Stream,
Generation of Code. The input Stream and codes may be stored in files.
2.
Write a C++ Object Oriented Code for representing a graph using adjacency list.
Perform depth first and breadth first search starting from any node. Also find the
shortest path between single sources all destinations. Also carry out topological
sorting.
3.
Create a C++ template for matrix. Include procedures for multiplication of 2
matrices. Use the same class for multiplication of more than two matrices.
4.
Create a C++ class for implementation of AVL tree to store a symbol table.
5.
Create a new string class say NewString. Define functions as defined in the system
string class.
27
4IT10 COMPUTER AIDED SOFTWARE ENGINEERING LAB
(Common to Comp. Engg. & Info. Tech)
Class: IV Sem. B.Tech.
Evaluation
Branch: I.T.
Examination Time = Three (4) Hours
Schedule per Week
Maximum Marks = 100
Practical Hrs : 3
[Sessional/Mid-term (60) & End-term (40)]
For the instructor: Assign any two projects two a group of exactly two students covering all of
the experiments from given experiment list. Each group is required to prepare the following
documents for projects assigned to them and develop the software using software engineering
methodology.
1.
2.
3.
4.
5.
6.
Problem Analysis and Project Planning Thorough study of the problem- identify project
scope, infrastructure.
Software Requirement Analysis- Describe the individual Phases/modules of the project
deliverables.
Data Modeling Use work products – data dictionary, use case diagrams and activity
diagrams, build and test lass diagrams, sequence diagrams and add interface to class
diagrams.
Software Developments and Debugging.
Software Testing – Prepare test plan, perform validation testing coverage analysis, memory
leaks, develop test case hierarchy, Site check and site monitor.
Describe: Relevance of CASE tools, high – end and low – end CASE tools, automated
support for data dictionaries, DFD, ER diagrams.
S. No.
List of Experiments
Software Required:
1
Course Registration System
2
Quiz System
Case Tools: Rational Suite, Win
runner, Empirix
3
Online ticket reservation system
4
Remote computer monitoring
5
Students marks analyzing system
Front
End:
VB,
Developer 2000, .NET
6
Expert system to prescribe the medicines for
the given symptoms
Back End: Oracle, MS – Access,
SQL
7
Platform assignment system for the trains in a
railway station
8
Stock maintenance
9
Student Marks Analyzing System
10
Online Ticket Reservation System
11
Payroll System
12
Export System
Languages: C/C++/JDK, JSDK,
INTERNET EXPLORER UML
VC++,
28
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7&20387(5$5&+,7(&785(&RPPRQWR&RPS(QJJ,QIR7HFK
&ODVV96HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV7XWRULDO
8QLWV
,
,,
,,,
,9
9
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
&RQWHQWVRIWKHVXEMHFW
,QWURGXFWLRQ WR &RPSXWHU $UFKLWHFWXUH DQG 2UJDQL]DWLRQ 9RQ 1HXPDQ
$UFKLWHFWXUH)O\QQ&ODVVLILFDWLRQ
5HJLVWHU 7UDQVIHU DQG 0LFUR RSHUDWLRQV 5HJLVWHU WUDQVIHU ODQJXDJH $ULWKPHWLF
0LFURRSHUDWLRQV /RJLF 0LFURRSHUDWLRQV 6KLIW 0LFURRSHUDWLRQV %XV DQG
PHPRU\WUDQVIHUV
&RPSXWHU 2UJDQL]DWLRQ DQG 'HVLJQ ,QVWUXFWLRQ F\FOH FRPSXWHU UHJLVWHUV
FRPPRQEXVV\VWHPFRPSXWHULQVWUXFWLRQVDGGUHVVLQJPRGHVGHVLJQRIDEDVLF
FRPSXWHU
&HQWUDO 3URFHVVLQJ 8QLW *HQHUDO UHJLVWHU RUJDQL]DWLRQ VWDFN RUJDQL]DWLRQ
,QVWUXFWLRQIRUPDWV'DWDWUDQVIHUDQGPDQLSXODWLRQSURJUDPFRQWURO
5,6&&,6&FKDUDFWHULVWLFV
3LSHOLQH DQG 9HFWRU SURFHVVLQJ 3LSHOLQH VWUXFWXUH VSHHGXS HIILFLHQF\
WKURXJKSXWDQGERWWOHQHFNV$ULWKPHWLFSLSHOLQHDQG,QVWUXFWLRQSLSHOLQH
&RPSXWHU $ULWKPHWLF $GGHU 5LSSOH FDUU\ $GGHU FDUU\ ORRN $KHDG
$GGHU 0XOWLSOLFDWLRQ $GG DQG 6KLIW $UUD\ PXOWLSOLHU DQG %RRWK
0XOWLSOLHU 'LYLVLRQ UHVWRULQJ DQG 1RQUHVWRULQJ 7HFKQLTXHV )ORDWLQJ
3RLQW $ULWKPHWLF )ORDWLQJ SRLQW UHSUHVHQWDWLRQ $GG 6XEWUDFW
0XOWLSOLFDWLRQ'LYLVLRQ
0HPRU\ 2UJDQL]DWLRQ 5$0 520 0HPRU\ +LHUDUFK\ 2UJDQL]DWLRQ
$VVRFLDWLYH PHPRU\ &DFKH PHPRU\ DQG 9LUWXDO PHPRU\ 3DJLQJ DQG
6HJPHQWDWLRQ
,QSXW2XWSXW 2UJDQL]DWLRQ ,QSXW2XWSXW ,QWHUIDFH 0RGHV RI 7UDQVIHU
3ULRULW\,QWHUUXSW'0$,23SURFHVVRU
5HIHUHQFHV
&RPSXWHU2UJDQL]DWLRQDQG$UFKLWHFWXUH:LOOLDP6WDOOLQJV3HDUVRQ(GXFDWLRQ$VLD
&RPSXWHU2UJDQL]DWLRQDQG$UFKLWHFWXUH-RKQ3+D\HV0F*UDZ+LOO
&RPSXWHU2UJDQL]DWLRQ9&DUO+DPDFKHU0F*UDZ+LOO
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7'LJLWDO6LJQDO3URFHVVLQJ,QIR7HFK
&ODVV96HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
8QLWV
&RQWHQWVRIWKHVXEMHFW
,
,,
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
,1752'8&7,21'LVFUHWHWLPHVLJQDOVDQGV\VWHPVSURSHUWLHVRIGLVFUHWHWLPH
V\VWHPV/LQHDUWLPHLQYDULDQWV\VWHPVGLVFUHWHWLPH3URSHUWLHVRI/7,V\VWHPV
DQG WKHLU EORFN GLDJUDPV &RQYROXWLRQ 'LVFUHWH WLPH V\VWHPV GHVFULEHG E\
GLIIHUHQFHHTXDWLRQV
)RXULHU 7UDQVIRUP 'LVFUHWH WLPH )RXULHU WUDQVIRUP IRU SHULRGLF DQG DSHULRGLF
VLJQDOV3URSHUWLHVRI'7)7=WUDQVIRUP7KHUHJLRQRIFRQYHUJHQFHIRUWKH=
WUDQVIRUP7KH,QYHUVH=WUDQVIRUP3URSHUWLHVRI=WUDQVIRUP
,,,
6$03/,1* 0DWKHPDWLFDO WKHRU\ RI VDPSOLQJ 6DPSOLQJ WKHRUHP ,GHDO 3UDFWLFDO VDPSOLQJ ,QWHUSRODWLRQ WHFKQLTXH IRU WKH UHFRQVWUXFWLRQ RI D VLJQDO
IURPLWVVDPSOHV$OLDVLQJ6DPSOLQJLQIUHTGRPDLQ6DPSOLQJRIGLVFUHWHWLPH
VLJQDOV
,9
7+( ',6&5(7( )285,(5 75$16)2506 ')7 3URSHUWLHV RI WKH ')7
/LQHDU&RQYROXWLRQXVLQJ')7(IILFLHQWFRPSXWDWLRQRIWKH')7'HFLPDWLRQ±
LQ7LPHDQG'HFLPDWLRQLQIUHTXHQF\))7$OJRULWKPV
9
),/7(5 '(6,*1 7(&+1,48(6 6WUXFWXUHV IRU GLVFUHWHWLPH V\VWHPV %ORFN
GLDJUDP DQG VLJQDO IORZ JUDSK UHSUHVHQWDWLRQ RI /&&' /&&' ± /LQHDU
&RQVWDQW &RHIILFLHQW 'LIIHUHQFH HTXDWLRQV %DVLF VWUXFWXUHV IRU ,,5 DQG ),5
V\VWHPV 7UDQVSRVHG IRUPV ,QWURGXFWLRQ WR ILOWHU 'HVLJQ %XWWHUZRUWK &KHE\VKHY ,,5 ILOWHU GHVLJQ E\ LPSXOVH LQYDULDQFH %LOLQHDU WUDQVIRUPDWLRQ
'HVLJQRI),5ILOWHUVE\:LQGRZLQJ5HFWDQJXODU+DPPLQJ.DLVHU
5HIHUHQFHV
2SSHQKHLP'LVFUHWH7LPH6LJQDO3URFHVVLQJH3HDUVRQ(GXFDWLRQ
3URDNLV'LJLWDO6LJQDO3URFHVVLQJH3HDUVRQ(GXFDWLRQ
6.0LWUD'LJLWDO6LJQDO3URFHVVLQJH7DWD0F*UDZ+LOO
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,77(/(&20081,&$7,21)81'$0(17$/6&RPPRQWR&RPS(QJJ
,QIR7HFK
&ODVV96HP%7HFK
(YDOXDWLRQ
%UDQFK,7
([DPLQDWLRQ7LPH 7KUHH+RXUV
6FKHGXOHSHU:HHN
0D[LPXP0DUNV /HFWXUHV
>0LGWHUP([email protected]
,
'DWD 7UDQVPLVVLRQ 7HUPLQRORJ\ )UHTXHQF\ VSHFWUXP EDQGZLGWK DQDORJ DQG GLJLWDO
WUDQVPLVVLRQ 7UDQVPLVVLRQ LPSDLUPHQWV FKDQQHO FDSDFLW\ LQFOXGLQJ VDPSOLQJ WKHRUHP
DQG)RXULHUVHULHV
7UDQVPLVVLRQ 0HGLD 7UDQVPLVVLRQ RI VLJQDOV WKURXJK 7ZLVWHG SDLU &RD[LDO FDEOH
RSWLFDOILEUH6000*UDGHG,QGH[
:LUHOHVV7UDQVPLVVLRQ$QWHQQDDQGDQWHQQDJDLQLQWURGXFWLRQWRWHUUHVWULDODQGVDWHOOLWH
PLFURZDYH3URSDJDWLRQRIZLUHOHVVVLJQDOVIUHHVSDFHORVVIRU/26FRPPXQLFDWLRQ
5HYLHZ RI /LQH (QFRGLQJ 6FKHPHV &RQFHSW RI ELW SHULRG HIIHFW RI FORFN VNHZ
6\QFKURQRXVDQG$V\QFKURQRXVFRPPXQLFDWLRQ
1HWZRUN5HIHUHQFH0RGHOV26,,62DQG7&3,3
,,
'DWD/LQN/D\HU)XQFWLRQVSHUIRUPHGE\GDWDOLQNOD\HU'DWDOLQN/D\HUGHVLJQLVVXHV
(UURU &RQWURO &RGLQJ (UURU 'HWHFWLRQ 7ZR 'LPHQVLRQDO 3DULW\ &KHFNV ,QWHUQHW
&KHFNVXP3RO\QRPLDO&RGHV6WDQGDUGL]HGSRO\QRPLDOFRGHVHUURUGHWHFWLQJFDSDELOLW\
RI D SRO\QRPLDO FRGHV /LQHDU FRGHV SHUIRUPDQFH RI OLQHDU FRGHV HUURU GHWHFWLRQ FRUUHFWLRQXVLQJOLQHDUFRGHV)ORZ&RQWURO)ORZFRQWUROLQORVVOHVVDQGORVV\FKDQQHOV
XVLQJ VWRSDQGZDLWVOLGLQJZLQGRZSURWRFROV3HUIRUPDQFHRISURWRFROVXVHGIRUIORZ
FRQWURO
,,,
'DWD/LQN&RQWURO+'/&333LQFOXGLQJIUDPHVWUXFWXUHV0$&VXEOD\HU3XUHDQG
VORWWHG$ORKD&60$&60$&'FROOLVLRQIUHHPXOWLSOHDFFHVV7KURXJKSXWDQDO\VLVRI
SXUHDQGVORWWHG$ORKDGHOD\WKURXJKSXWDQDO\VLVRI&60$DQG&60$&'
,9
0XOWLSOH[LQJ )UHTXHQF\ GLYLVLRQ WLPH GLYLVLRQ 6\QFKURQRXV DQG VWDWLVWLFDO
PXOWLSOH[LQJ$'6/'6DQG'6FDUULHUV0XOWLSOH$FFHVVHV3HUIRUPDQFHRI)'0$
)0)'0$6LQJOHFKDQQHOSHUFDUULHU7'0$IUDPHVWUXFWXUH7'0$%XUVW6WUXFWXUH
7'0$ )UDPH HIILFLHQF\ 7'0$ 6XSHUIUDPH VWUXFWXUH )UDPH DFTXLVLWLRQ DQG
V\QFKURQL]DWLRQ 6OLS UDWH DQG LQ GLJLWDO WHUUHVWULDO QHWZRUNV 6ZLWFKLQJ 4XDOLWDWLYH
GHVFULSWLRQRI6SDFHGLYLVLRQWLPHGLYLVLRQDQGVSDFHWLPHVSDFHGLYLVLRQVZLWFKLQJ
9
6SUHDG 6SHFWUXP 7HFKQLTXHV 'LUHFW VHTXHQFH'666 IUHTXHQF\ KRSSLQJ)+66
3HUIRUPDQFH FRQVLGHUDWLRQ LQ '666 )+66 &RGH GLYLVLRQ 0XOWLSOH DFFHVV &'0$
IUHTXHQF\ FKDQQHO VSHFLILFDWLRQV IRUZDUG UHYHUVH &'0$ FKDQQHO SVHXGR
QRLVH31 VHTXHQFHV PVHTXHQFH JROG VHTXHQFH RUWKRJRQDO FRGH JROG VHTXHQFHV
:DOVKFRGHVV\QFKURQL]DWLRQSRZHUFRQWUROKDQGRIIFDSDFLW\RI&'0$V\VWHP,07
:&'0
5HIHUHQFHV
6WDOOLQJV'DWDDQGFRPSXWHUFRPPXQLFDWLRQWKHG3HDUVRQ
7UL7+D'LJLWDO6DWHOOLWH&RPPXQLFDWLRQVH7DWD0F*UDZ+LOO
$OEHUWR /HRQ*DUFLD ,QGUD :LGMDMD &20081,&$7,21 1(7:25.6 QG HG
70+
:LUHOHVVFRPPXQLFDWLRQVH5DSSDSRUW3+,
$QDO\VLV RI &RPSXWHU DQG &RPPXQLFDWLRQ 1HWZRUNV ,6%1 )D\H]
*HEDOL6SULQJHU9HUODJVW(G
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7'$7$%$6(0$1$*(0(176<67(06&RPPRQWR&RPS(QJJ,QIR
&ODVV96HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
7HFK
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
8QLWV
,
,,
,,,
,9
9
5HIHUHQFHV
&RQWHQWVRIWKHVXEMHFW
,QWURGXFWLRQ$SSOLFDWLRQV3XUSRVH)LOH6\VWHPYV'%06'DWD$EVWUDFWLRQ
,QWURGXFWLRQ
YLHZV 6WUXFWXUH RI D '%064XHU\ 3URFHVVRU 'DWDEDVH 8VHUV DQG
$GPLQLVWUDWRU'DWD'LFWLRQDU\7UDQVDFWLRQ0DQDJHU6WRUDJH0DQDJHU'DWD
0RGHOV,QWURGXFWLRQ1HWZRUN0RGHO+LHUDUFKLFDO0RGHO5HODWLRQDO0RGHO
(QWLW\5HODWLRQVKLS0RGHODQG2EMHFW2ULHQWHG0RGHO>@
(QWLW\ 5HODWLRQVKLS 0RGHO
0RGHO 6WUXFWXUH RI 5'06 DQG 'DWDEDVH 6FKHPD
(QWLWLHV $WWULEXWHV DQG (QWLW\ 6HWV 5HODWLRQVKLS DQG 5HODWLRQVKLS 6HWV .H\
&RQVWUDLQWV 3DUWLFLSDWLRQ &RQVWUDLQWV 0DSSLQJ &DUGLQDOLWLHV ,QWHJULW\
&RQVWUDLQWV:HDN(QWLW\6HW'HVLJQLVVXHV([WHQGHG)HDWXUHV$JJUHJDWLRQ
*HQHUDOL]DWLRQDQG6SHFLDOL]DWLRQFDVHVWXG\RIDQ(QWHUSULVH>@
5HODWLRQDO $OJHEUD
$OJHEUD 2SHUDWLRQV 6HOHFWLRQ 3URMHFWLRQ 6HW 5HQDPLQJ -RLQWV
'LYLVLRQ 5HODWLRQDO FDOFXOXV 7XSOH 5HODWLRQDO &DOFXOXV 'RPDLQ 5HODWLRQDO
&DOFXOXV>@
4XHU\ /DQJXDJHV 3URFHGXUDO DQG 1RQ 3URFHGXUDO ''/ '&/ DQG '0/
64/&ODXVHV 1HVWHG 4XHULHV 64/ )XQFWLRQV 6LQJOH 5RZ )XQFWLRQ
0XOWLJURXS )XQFWLRQV 6HW 2SHUDWLRQV $JJUHJDWH 2SHUDWRUV 1XOO 9DOXHV
(PEHGGHG64/'\QDPLF64/>@
6FKHPD 5HILQHPHQW $QG 1RUPDO )RUPV
)RUPV ,QWURGXFWLRQV WR 6FKHPD
5HILQHPHQW )XQFWLRQDO 'HSHQGHQFLHV %R\FH&RGG 1RUPDO )RUPV 7KLUG
1RUPDO)RUP1RUPDOL]DWLRQ'HFRPSRVLWLRQLQWR%&1)'HFRPSRVLWLRQLQWR
1)'HQRUPDOL]DWLRQ7ULJJHUV>@
7UDQVDFWLRQ 3URFHVVLQJ ,QWURGXFWLRQ7UDQVDFWLRQ 6WDWH 7UDQVDFWLRQ
SURSHUWLHV &RQFXUUHQW ([HFXWLRQV 1HHG RI 6HULDOL]DELOLW\&RQIOLFW YV 9LHZ
6HULDOL]DELOLW\7HVWLQJIRU6HULDOL]DELOLW\5HFRYHUDEOH6FKHGXOHV&DVFDGHOHVV
6FKHGXOHV>@
&RQFXUUHQF\&RQWURO,PSOHPHQWDWLRQRI&RQFXUUHQF\/RFNEDVHGSURWRFROV
&RQFXUUHQF\&RQWURO
7LPHVWDPSEDVHG SURWRFROV 9DOLGDWLRQEDVHG SURWRFROV 'HDGORFN KDQGOLQJ
>@
'DWDEDVH )DLOXUH DQG 5HFRYHU\
5HFRYHU\ 'DWDEDVH )DLOXUHV 5HFRYHU\ 6FKHPHV
6KDGRZ 3DJLQJ DQG /RJEDVHG 5HFRYHU\ 5HFRYHU\ ZLWK &RQFXUUHQW
WUDQVDFWLRQV>@
7UHH,QGH[)LOHV
,QGH[LQJDQG+DVKLQJ%DVLF&RQFHSWV2UGHUHG,QGLFHV%
,QGH[LQJDQG+DVKLQJ
%7UHH,QGH[)LOHV0XOWLSOH.H\$FFHVV6WDWLF+DVKLQJ'\QDPLF+DVKLQJ
&RPSDULVRQRI2UGHUHG,QGH[LQJDQG+DVKLQJ%LWPDS,QGLFHV,QGH[
'HILQLWLRQLQ64/>@
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
7H[W5HIHUHQFHV
+I.RUWKDQG6LOEHUVFKDW]'DWDEDVH6\VWHPV&RQFHSWV0F*UDZ+LOO
$OPDVULDQG6%1DYDWKH)XQGDPHQWDOVRI'DWDEDVH6\VWHPV
5DPDNULVKQDQDQG*HKUNH'DWDEDVH0DQDJHPHQW6\VWHP0F*UDZ+LOO
&-'DWH'DWD%DVH'HVLJQ$GGLVRQ:HVOH\
+DQVHQDQG+DQVHQ'%0DQG'HVLJQ3+,
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,723(5$7,1*6<67(06&RPPRQWR&RPS(QJJ,QIR7HFK
&ODVV96HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
8QLWV
&RQWHQWVRIWKHVXEMHFW
,
,QWURGXFWLRQ DQG QHHG RI RSHUDWLQJ V\VWHP OD\HUHG DUFKLWHFWXUHORJLFDO VWUXFWXUH RI RSHUDWLQJ
V\VWHP7\SHRI26RSHUDWLQJV\VWHPDVUHVRXUFHPDQDJHUDQGYLUWXDOPDFKLQH26VHUYLFHV%,26
6\VWHP&DOOV0RQLWRU&DOOV)LUPZDUH%,26%RRW6WUDS/RDGHU
3URFHVVPDQDJHPHQW
3URFHVVPDQDJHPHQW3URFHVVPRGHOFUHDWLRQWHUPLQDWLRQVWDWHVWUDQVLWLRQVKLHUDUFK\FRQWH[W
VPDQDJHPHQW
VZLWFKLQJSURFHVVLPSOHPHQWDWLRQSURFHVVFRQWUROEORFN%DVLF6\VWHPFDOOV/LQX[:LQGRZV
7KUHDGVSURFHVVHVYHUVXVWKUHDGVWKUHDGLQJFRQFHSWVPRGHOVNHUQHOXVHUOHYHOWKUHDGVWKUHDG
XVDJHEHQHILWVPXOWLWKUHDGLQJPRGHOV
,QWHUSURFHVV FRPPXQLFDWLRQ
FRPPXQLFDWLRQ ,QWURGXFWLRQ WR PHVVDJH SDVVLQJ 5DFH FRQGLWLRQ FULWLFDO VHFWLRQ
SUREOHPPXWXDOH[FOXVLRQZLWKEXV\ZDLWLQJGLVDEOLQJLQWHUUXSWVORFNYDULDEOHVVWULFWDOWHUDWLRQ
3HWHUVRQ¶V VROXWLRQ 76/ LQVWUXFWLRQV EXV\ ZDLWLQJ VOHHS DQG ZDNHXS FDOOV VHPDSKRUH PRQLWRUV
FODVVLFDO,3&SUREOHPV
3URFHVV VFKHGXOLQJ
VFKHGXOLQJ %DVLF FRQFHSWV FODVVLILFDWLRQ &38 DQG ,2 ERXQG &38 VFKHGXOHU VKRUW
PHGLXP ORQJWHUP GLVSDWFKHUVFKHGXOLQJ SUHHPSWLYHDQG QRQSUHHPSWLYH6WDWLF DQG'\QDPLF
3ULRULW\ &RRSHUDWLYH 1RQFRRSHUDWLYH &ULWHULD*RDOV3HUIRUPDQFH 0HWULFV VFKHGXOLQJ
DOJRULWKPV)&)66-)6VKRUWHVWUHPDLQLQJWLPH5RXQGURELQ3ULRULW\VFKHGXOLQJPXOWLOHYHOTXHXH
VFKHGXOLQJPXOWLOHYHOIHHGEDFNTXHXHVFKHGXOLQJ)DLUVKDUHVFKHGXOLQJ
'HDGORFN6\VWHPPRGHOUHVRXUFHW\SHVGHDGORFNSUREOHPGHDGORFNFKDUDFWHUL]DWLRQPHWKRGVIRU
'HDGORFN
GHDGORFN KDQGOLQJ GHDGORFN SUHYHQWLRQ GHDGORFN DYRLGDQFH GHDGORFN GHWHFWLRQ UHFRYHU\ IURP
GHDGORFN
0HPRU\ PDQDJHPHQW
PDQDJHPHQW FRQFHSWV IXQFWLRQV ORJLFDO DQG SK\VLFDO DGGUHVV VSDFH DGGUHVV ELQGLQJ
GHJUHHRIPXOWLSURJUDPPLQJVZDSSLQJVWDWLFG\QDPLFORDGLQJFUHDWLQJDORDGPRGXOHORDGLQJ
VWDWLF G\QDPLF OLQNLQJ VKDUHG OLEUDULHV PHPRU\ DOORFDWLRQ VFKHPHV ILUVW ILW QH[W ILW EHVW ILW
ZRUVW ILW TXLFN ILW )UHH VSDFH PDQDJHPHQW ELWPDS OLQN OLVWIUHH OLVW EXGG\¶V V\VWHP PHPRU\
SURWHFWLRQDQGVKDULQJUHORFDWLRQDQGDGGUHVVWUDQVODWLRQ
9LUWXDO 0HPRU\
0HPRU\ FRQFHSW YLUWXDO DGGUHVV VSDFH SDJLQJ VFKHPH SXUH VHJPHQWDWLRQ DQG
VHJPHQWDWLRQ ZLWK SDJLQJ VFKHPH KDUGZDUH VXSSRUW DQG LPSOHPHQWDWLRQ GHWDLOV PHPRU\
IUDJPHQWDWLRQGHPDQGSDJLQJSUHSDJLQJZRUNLQJVHWPRGHOSDJHIDXOWIUHTXHQF\WKUDVKLQJSDJH
UHSODFHPHQWDOJRULWKPVRSWLPDO158),)2VHFRQGFKDQFH/58/58DSSUR[LPDWLRQFORFN:6
FORFN %HODG\¶V DQRPDO\ GLVWDQFH VWULQJ GHVLJQ LVVXHV IRU SDJLQJ V\VWHP ORFDO YHUVXV JOREDO
DOORFDWLRQ SROLFLHV ORDG FRQWURO SDJH VL]H VHSDUDWH LQVWUXFWLRQ DQG GDWD VSDFHV VKDUHG SDJHV
FOHDQLQJ SROLF\ 7/% WUDQVODWLRQ ORRN DVLGH EXIIHU UHDFK LQYHUWHG SDJH WDEOH ,2 LQWHUORFN
SURJUDPVWUXFWXUHSDJHIDXOWKDQGOLQJ%DVLFLGHDRI00LQ/LQX[ZLQGRZV
)LOH 6\VWHP
6\VWHP FRQFHSWV QDPLQJ DWWULEXWHV RSHUDWLRQV W\SHV VWUXFWXUH ILOH RUJDQL]DWLRQ DFFHVV6HTXHQWLDO 'LUHFW ,QGH[ 6HTXHQWLDO PHWKRGV PHPRU\ PDSSHG ILOHV GLUHFWRU\ VWUXFWXUHV
RQH OHYHO WZR OHYHO KLHUDUFKLFDOWUHH DF\FOLF JUDSK JHQHUDO JUDSK ILOH V\VWHP PRXQWLQJ ILOH
VKDULQJSDWKQDPHGLUHFWRU\RSHUDWLRQVRYHUYLHZRIILOHV\VWHPLQ/LQX[ZLQGRZV
,QSXW2XWSXW VXEV\VWHPV FRQFHSWV IXQFWLRQVJRDOV LQSXWRXWSXW GHYLFHV EORFN DQG FKDUDFWHU
VSRROLQJ GLVN VWUXFWXUH RSHUDWLRQ GLVN DWWDFKPHQW GLVN VWRUDJH FDSDFLW\ GLVN VFKHGXOLQJ
DOJRULWKP)&)6667)VFDQVFKHGXOLQJ&VFDQVFKHGXOH
,,
,,,
,9
9
7H[W5HIHUHQFH%RRNV
7H[W5HIHUHQFH%RRNV
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
$6LOEHUVFKDW]DQG3HWHU%*DOYLQ2SHUDWLQJ6\VWHP3ULQFLSDOV:LOH\,QGLD3YW/WG
$FK\XW6*RGEROH2SHUDWLQJ6\VWHPV7DWD0F*UDZ+LOO
7DQHQEDXP0RGHUQ2SHUDWLQJ6\VWHP3UHQWLFH+DOO
'0'KDPGKHUH2SHUDWLQJ6\VWHPV±$&RQFHSWV%DVHG$SSURDFK7DWD0F*UDZ+LOO
&KDUOHV&URZO\2SHUDWLQJ6\VWHP$'HVLJQ±2ULHQWHG$SSURDFK7DWD0F*UDZ+LOO
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7$'9$1&(''$7$6758&785(&RPPRQWR&RPS(QJJ,QIR7HFK
&ODVV96HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
8QLWV
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
&RQWHQWVRIWKHVXEMHFW
,
$'9$1&(' 75((6 'HILQLWLRQV 2SHUDWLRQV RQ :HLJKW %DODQFHG 7UHHV
+XIIPDQ 7UHHV 7UHHV DQG 5HG %ODFN 7UHHV '\QDPLF 2UGHU 6WDWLVWLFV
,QWHUYDO7UHH'LFWLRQDULHV
,,
0(5*($%/( +($36 0HUJHDEOH +HDS 2SHUDWLRQV %LQRPLDO 7UHHV
,PSOHPHQWLQJ%LQRPLDO+HDSVDQGLWV2SHUDWLRQV7UHHVDQG+HDSV
$PRUWL]DWLRQDQDO\VLVDQG 3RWHQWLDO)XQFWLRQRI)LERQDFFL+HDS ,PSOHPHQWLQJ
)LERQDFFL+HDS
*5$3+ 7+(25< '(),1,7,216 'HILQLWLRQV RI ,VRPRUSKLF &RPSRQHQWV
&LUFXLWV)XQGDPHQWDO&LUFXLWV&XWVHWV&XW9HUWLFHV3ODQHU DQG'XDO JUDSKV
6SDQQLQJ7UHHV.XUDWRYVNL
VWZR*UDSKV
,,,
*5$3+7+(25<$/*25,7+06$OJRULWKPVIRU&RQQHFWHGQHVV)LQGLQJDOO
6SDQQLQJ 7UHHV LQ D :HLJKWHG *UDSK %UHDGWK )LUVW DQG 'HSWK )LUVW 6HDUFK
7RSRORJLFDO 6RUW 6WURQJO\ &RQQHFWHG &RPSRQHQWV DQG $UWLFXODWLRQ 3RLQW
6LQJOH 0LQ&XW 0D[)ORZ WKHRUHP RI 1HWZRUN )ORZV )RUG)XONHUVRQ 0D[
)ORZ$OJRULWKPV
6257,1* 1(7:25. &RPSDULVRQ QHWZRUN ]HURRQH SULQFLSOH ELWRQLF
VRUWLQJDQGPHUJLQJQHWZRUNVRUWHU
,9
3ULRULW\4XHXHVDQG&RQFDWHQDEOH4XHXHVXVLQJ7UHHV
2SHUDWLRQVRQ'LVMRLQWVHWVDQGLWVXQLRQILQGSUREOHP,PSOHPHQWLQJ6HWV
9
180%(5 7+(25,7,& $/*25,7+0 1XPEHU WKHRUHWLF QRWLRQV 'LYLVLRQ
WKHRUHP*&'UHFXUVLRQ0RGXODUDULWKPHWLF6ROYLQJ0RGXODU/LQHDUHTXDWLRQ
&KLQHVH 5HPDLQGHU 7KHRUHP SRZHU RI DQ HOHPHQW &RPSXWDWLRQ RI 'LVFUHWH
/RJDULWKPVSULPDOLW\7HVWLQJDQG,QWHJHU)DFWRUL]DWLRQ
5HIHUHQFHV
&RUPHQ/HLVHUVRQ5LYHVW,QWURGXFWLRQWR$OJRULWKPV3UHQWLFH+DOORI,QGLD
+RURZLW]DQG6DKDQL)XQGDPHQWDORI&RPSXWHUDOJRULWKPV
$KR$9-'8OPDQ'HVLJQDQGDQDO\VLVRI$OJRULWKPV$GGLVRQ:HVOH\
%UDVVDUG)XQGDPHQWDORI$OJRULWKPLFV3+,
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7(&RPPHUFH,QIR7HFK
&ODVV96HP%7HFK
(YDOXDWLRQ
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
8QLWV
&RQWHQWVRIWKHVXEMHFW
,
,QWURGXFWLRQ 0RWLYDWLRQ )RUFHV EHKLQG (&RPPHUFH ,QGXVWU\ )UDPHZRUN %ULHI
KLVWRU\ RI (FRPPHUFH ,QWHU 2UJDQL]DWLRQDO (&RPPHUFH ,QWUD 2UJDQL]DWLRQDO
(&RPPHUFH DQG &RQVXPHU WR %XVLQHVV (OHFWURQLF &RPPHUFH $UFKLWHFWXUDO
IUDPHZRUN 1HWZRUN ,QIUDVWUXFWXUH IRU (&RPPHUFH 1HWZRUN ,QIUDVWUXFWXUH IRU
(&RPPHUFH 0DUNHW IRUFHV EHKLQG , :D\ &RPSRQHQW RI , ZD\ $FFHVV (TXLSPHQW
*OREDO,QIRUPDWLRQ'LVWULEXWLRQ1HWZRUN%URDGEDQG7HOHFRPPXQLFDWLRQ
,,
0RELOH &RPPHUFH ,QWURGXFWLRQ WR 0RELOH &RPPHUFH 0RELOH &RPSXWLQJ
$SSOLFDWLRQ :LUHOHVV $SSOLFDWLRQ 3URWRFROV :$3 7HFKQRORJ\ 0RELOH ,QIRUPDWLRQ
'HYLFHV :HE 6HFXULW\ ,QWURGXFWLRQ WR :HE VHFXULW\ )LUHZDOOV 7UDQVDFWLRQ
6HFXULW\&OLHQW6HUYHU1HWZRUN(PHUJLQJ&OLHQW6HUYHU6HFXULW\7KUHDWVILUHZDOOV
1HWZRUN6HFXULW\
,,,
(QFU\SWLRQ :RUOG :LGH :HE 6HFXULW\ (QFU\SWLRQ 7UDQVDFWLRQ VHFXULW\ 6HFUHW
.H\ (QFU\SWLRQ 3XEOLF .H\ (QFU\SWLRQ 9LUWXDO 3ULYDWH 1HWZRUN 930
,PSOHPHQWDWLRQ0DQDJHPHQW,VVXHV
,9
(OHFWURQLF 3D\PHQWV 2YHUYLHZ RI (OHFWURQLFV SD\PHQWV 'LJLWDO 7RNHQ EDVHG
(OHFWURQLFV SD\PHQW 6\VWHP 6PDUW &DUGV &UHGLW &DUG , 'HELW &DUG EDVHG (36
(PHUJLQJILQDQFLDO,QVWUXPHQWV+RPH%DQNLQJ2QOLQH%DQNLQJ
9
1HW &RPPHUFH ('$ (', $SSOLFDWLRQ LQ %XVLQHVV /HJDO UHTXLUHPHQW LQ ( ±
&RPPHUFH ,QWURGXFWLRQ WR VXSSO\ &KDLQ 0DQDJHPHQW &50 LVVXHV LQ &XVWRPHU
5HODWLRQVKLS0DQDJHPHQW
5HIHUHQFHV
(OHFWURQLFHFRPPHUFH,,(GLWLRQ3HWH/RVKLQ3DXO$0XUSK\-DLFRERRN
7KH%XVLQHVVRIHFRPPHUFH3DXO0D\&DPEULGJH8QLYHUVLW\3UHVV
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,76$7(//,7(0,&52:$9(&20081,&$7,21,QIR7HFK
&ODVV96HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
8QLWV
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
&RQWHQWVRIWKHVXEMHFW
,
:$9( *8,'(6 ,QWURGXFWLRQ RI 0LFURZDYHV DQG WKHLU DSSOLFDWLRQV
5HFWDQJXODU :DYHJXLGHV 6ROXWLRQ RI :DYH HTXDWLRQ LQ 7( DQG 70 PRGHV
3RZHU WUDQVPLVVLRQ DQG 3RZHU ORVVHV ([FLWDWLRQ RI PRGHV LQ 5HFWDQJXODU
ZDYHJXLGHV FLUFXODU ZDYHJXLGHV %DVLF LGHD RI 7( DQG 70 PRGHV ILHOG
SDWWHUQV7(0PRGHRISURSDJDWLRQ
,,
:$9(*8,'(&20321(1766FDWWHULQJPDWUL[UHSUHVHQWDWLRQRIQHWZRUNV
5HFWDQJXODUFDYLW\DQGFLUFXODUFDYLW\UHVRQDWRUV:DYHJXLGH7HHV0DJLF7HHV
+\EULG ULQJV :DYHJXLGH FRUQHUV %HQGV DQG WZLVWV 'LUHFWLRQDO FRXSOHUV
&LUFXODWRUVDQGLVRODWRUV%URDGEDQG:LUHOHVV
,,,
(OHPHQWV RI VDWHOOLWH FRPPXQLFDWLRQ )UHTXHQF\ EDQGV 7UDQVPLVVLRQ DQG
PXOWLSOH[LQJ0RGXODWLRQ0XOWLSOHDFFHVVWHFKQLTXHV
,9
6DWHOOLWH RUELW DQG GHVFULSWLRQ RUELWDO SHULRG DQG YHORFLW\ HIIHFWV RI RUELWDO
LQFOLQDWLRQ $]LPXWK DQG HOHYDWLRQ &RYHUDJH DQJOH DQG VODQW UDQJH
*HRVWDWLRQDU\RUELW
9
6DWHOOLWHGHVFULSWLRQ&RPPXQLFDWLRQVVXEV\VWHPV(DUWK6WDWLRQ$QWHQQDKLJK
SRZHUDPSOLILHUORZQRLVHDPSOLILHUXSFRQYHUWHUGRZQFRQYHUWHUPRQLWRULQJ
DQGFRQWUROUHOLDELOLW\6DWHOOLWH/LQNEDVLFOLQNDQDO\VLV
5HIHUHQFHV
/LDR0LFURZDYH'HYLFHVDQG&LUFXLWVH3HDUVRQ(GXFDWLRQ
7UL7+D'LJLWDO6DWHOOLWH&RPPXQLFDWLRQVH7DWD0F*UDZ+LOO &RPPXQLFDWLRQ6\VWHPV6LPRQ+D\NLQ-RKQ:LOH\
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7'$7$%$6(/$%&RPPRQWR&RPS(QJJ,QIR7HFK
&ODVV96HP%7HFK
(YDOXDWLRQ
%UDQFK,7
6FKHGXOHSHU:HHN
3UDFWLFDO+UV
([DPLQDWLRQ7LPH )RXU+RXUV
0D[LPXP0DUNV >6HVVLRQDO0LGWHUP(QGWHUP
@
2EMHFWLYHV $W WKH HQG RI WKH VHPHVWHU WKH VWXGHQWV VKRXOG KDYH FOHDUO\
XQGHUVWRRGDQGLPSOHPHQWHGWKHIROORZLQJ
6WDWLQJDGDWDEDVHGHVLJQSUREOHP
3UHSDULQJ(5GLDJUDP
)LQGLQJWKHGDWDILHOGVWREHXVHGLQWKHGDWDEDVH
6HOHFWLQJILHOGVIRUNH\V
1RUPDOL]LQJ WKH
GHSHQGHQFLHV
GDWDEDVH
LQFOXGLQJ
DQDO\VLV
RI
IXQFWLRQDO
,QVWDOOLQJDQGFRQILJXULQJWKHGDWDEDVHVHUYHUDQGWKHIURQWHQGWRROV
'HVLJQLQJ GDWDEDVH DQG ZULWLQJ DSSOLFDWLRQV IRU PDQLSXODWLRQ RI GDWD
IRU D VWDQG DORQH DQG VKDUHG GDWD EDVH LQFOXGLQJ FRQFHSWV OLNH
FRQFXUUHQF\ FRQWURO WUDQVDFWLRQ UROO EDFN ORJJLQJ UHSRUW JHQHUDWLRQ
HWF
*HWDFTXDLQWHGZLWK64/
,QRUGHUWRDFKLHYHWKHDERYHREMHFWLYHVLWLVH[SHFWHGWKDWHDFKVWXGHQWVZLOO
FKRVHRQHSUREOHP7KHLPSOHPHQWDWLRQVKDOOEHLQJZLWKWKHVWDWHPHQWRIWKH
REMHFWLYHV WR EH DFKLHYHG SUHSDULQJ (5 GLDJUDP GHVLJQLQJ RI GDWDEDVH
QRUPDOL]DWLRQDQGILQDOO\PDQLSXODWLRQRIWKHGDWDEDVHLQFOXGLQJJHQHUDWLRQRI
UHSRUWV YLHZV HWF 7KH SUREOHP PD\ ILUVW EH LPSOHPHQWHG IRU D VWDQGDORQH
V\VWHPWREHXVHGE\DVLQJOHXVHU
$OO WKH DERYH VWHSV PD\ WKHQ EH IROORZHG IRU GHYHORSPHQW RI D GDWDEDVH
DSSOLFDWLRQ WR EH XVHG E\ PXOWLSOH XVHUV LQ D FOLHQW VHUYHU HQYLURQPHQW ZLWK
DFFHVVFRQWURO7KHDSSOLFDWLRQVKDOO127XVHZHEWHFKQLTXHV
2QHH[HUFLVHPD\EHDVVLJQHGRQFUHDWLRQRIWDEOHPDQLSXODWLRQRIGDWDDQG
UHSRUWJHQHUDWLRQXVLQJ64/
6XJJHVWHG7RROV
)RU VWDQGDORQH HQYLURQPHQW 9LVXDO )R[3UR RU DQ\ VLPLODU GDWDEDVH KDYLQJ
ERWKWKHGDWDEDVHDQGPDQLSXODWLRQODQJXDJHPD\EHXVHG
)RUPXOWLXVHUDSSOLFDWLRQ0<6TOLVVXJJHVWHG+RZHYHUDQ\RWKHUGDWDEDVH
PD\ DOVR EH XVHG )RU IURQW HQG 9%1HW -DYD 9% 6FULSW RU DQ\ RWKHU
FRQYHQLHQWEXWFXUUHQWO\XVHGE\LQGXVWU\PD\EHFKRVHQ
,QGLFDWLYH/LVWRIH[HUFLVHV
6WXGHQWLQIRUPDWLRQV\VWHPIRU\RXUFROOHJH
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
6WXGHQWJULHYDQFHUHJLVWUDWLRQDQGUHGUHVVDOV\VWHP
$YLGHROLEUDU\PDQDJHPHQWV\VWHPIRUDVKRS
,QYHQWRU\PDQDJHPHQWV\VWHPIRUDKDUGZDUHVDQLWDU\LWHPVKRS
,QYHQWRU\PDQDJHPHQWV\VWHPIRU\RXUFROOHJH
*XDUDQWHHPDQDJHPHQWV\VWHPIRUWKHHTXLSPHQWVLQ\RXUFROOHJH
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7$'9$1&(&20081,&$7,21/$%,QIR7HFK
&ODVV96HP%7HFK
(YDOXDWLRQ
%UDQFK,7
6FKHGXOHSHU:HHN
3UDFWLFDO+UV
([DPLQDWLRQ7LPH )RXU+RXUV
0D[LPXP0DUNV >6HVVLRQDO0LGWHUP(QGWHUP
@
61R
7'0RIWZREDQGOLPLWHGVLJQDOV
$6.DQG)6.JHQHUDWLRQDQGGHWHFWLRQ
36.JHQHUDWLRQDQGGHWHFWLRQ
'36.JHQHUDWLRQDQGGHWHFWLRQ
436.JHQHUDWLRQDQGGHWHFWLRQ
3&0JHQHUDWLRQDQGGHWHFWLRQXVLQJD&2'(&&KLS
0HDVXUHPHQWRIORVVHVLQDJLYHQRSWLFDOILEHUSURSDJDWLRQORVVEHQGLQJ
ORVVDQGQXPHULFDODSHUWXUH
$QDORJDQG'LJLWDOZLWK7'0FRPPXQLFDWLRQOLQNXVLQJRSWLFDOILEHU
/LVWRI([SHULPHQWV
0HDVXUHPHQW RI IUHTXHQF\ JXLGH ZDYHOHQJWK SRZHU 96:5 DQG
DWWHQXDWLRQLQDPLFURZDYHWHVWEHQFK
0HDVXUHPHQW RI GLUHFWLYLW\ DQG JDLQ RI DQWHQQDV 6WDQGDUG GLSROH RU
SULQWHGGLSROHPLFURVWULSSDWFKDQWHQQDDQG<DJLDQWHQQDSULQWHG
'HWHUPLQDWLRQ RI FRXSOLQJ DQG LVRODWLRQ FKDUDFWHULVWLFV RI D VWULSOLQH RU
PLFURVWULSGLUHFWLRQDOFRXSOHU
D 0HDVXUHPHQW RI UHVRQDQFH FKDUDFWHULVWLFV RI D PLFURVWULS ULQJ
UHVRQDWRU DQG GHWHUPLQDWLRQ RI GLHOHFWULF FRQVWDQW RI WKH VXEVWUDWH
E 0HDVXUHPHQW RI SRZHU GLYLVLRQ DQG LVRODWLRQ FKDUDFWHULVWLFV RI D
PLFURVWULSG%SRZHUGLYLGHU
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,723(5$7,1*6<67(066,08/$7,21/$%&RPPRQWR&RPS(QJJ
,QIR7HFK
&ODVV96HP%7HFK
(YDOXDWLRQ
%UDQFK,7
6FKHGXOHSHU:HHN
3UDFWLFDO+UV
([DPLQDWLRQ7LPH )RXU+RXUV
0D[LPXP0DUNV >6HVVLRQDO0LGWHUP(QGWHUP
@
2EMHFWLYHV
¾ 8QGHUVWDQGWKHEDVLFIXQFWLRQVRIRSHUDWLQJV\VWHPV
¾ ,QGHSWKNQRZOHGJHRIWKHDOJRULWKPVXVHGIRULPSOHPHQWLQJWKHWDVNVSHUIRUPHG
E\WKHRSHUDWLQJV\VWHPV
¾ 8QGHUVWDQGVLPXODWHVWUDWHJLHVXVHGLQ/LQX[:LQGRZVRSHUDWLQJV\VWHPV
¾ 'HYHORSDSWLWXGHIRUFDUU\LQJRXWUHVHDUFKLQWKHDUHDRIRSHUDWLQJV\VWHP
6XJJHVWHG7RROV
2SHUDWLQJV\VWHPVLPXODWRU0266SUHIHUDEO\RQ/LQX[SODWIRUP
5HFRPPHQGHG([FHUFLVHV
$ ([HUFLVHVVKDOOEHJLYHQRQVLPXODWLRQRIDOJRULWKPVXVHGIRUWKHWDVNV
SHUIRUPHGE\WKHRSHUDWLQJV\VWHPV)ROORZLQJPRGXOHVRIWKHVLPXODWRUPD\
EHXVHG
¾
6FKHGXOLQJ
¾
'HDGORFN
¾
0HPRU\0DQDJHPHQW6\VWHPV
¾
)LOHV\VWHPVLPXODWRU
$OJRULWKPVGHVFULEHGLQWKHWH[WPD\EHDVVLJQHG7KHVLPXODWLRQUHVXOWVVXFKDV
DYHUDJHODWHQF\KLW0LVV5DWLRVRURWKHUSHUIRUPDQFHSDUDPHWHUVPD\EH
FRPSXWHG
% 2QHH[HUFLVHVKDOOEHRQVLPXODWLRQRIDOJRULWKPVUHSRUWHGLQWKHUHFHQW
FRQIHUHQFHVMRXUQDOVDQGUHSURGXFLQJWKHUHVXOWVUHSRUWHGWKHUHLQ
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7',*,7$/+$5':$5('(6,*1/$%&RPPRQWR&RPS(QJJ
,QIR7HFK
&ODVV9,6HP%7HFK
(YDOXDWLRQ
%UDQFK,7
6FKHGXOHSHU:HHN
3UDFWLFDO+UV
([DPLQDWLRQ7LPH )RXU+RXUV
0D[LPXP0DUNV >6HVVLRQDO0LGWHUP(QGWHUP
@
2EMHFWLYHV$WWKHHQGRIFRXUVHWKHVWXGHQWVVKDOOEHDEOHWR
x 6KRXOGEHDEOHWRGHVLJQGDWDSDWKIRUGLJLWDOV\VWHPV
x &UHDWHDGLJLWDOV\VWHPXVLQJGLVFUHWHGLJLWDO,&V
x 'HVLJQDKDUGZLUHGPLFURSURJUDPPHGFRQWUROFLUFXLW
x 6LPXODWHDGLJLWDOGDWDSDWKLQ+DUGZDUH'HVFULSWLRQ/DQJXDJH
x 8QGHUVWDQG,&GHVFULSWLRQVDQGVHOHFWSURSHU,&LQDJLYHQFLUFXLWEDVHGRQLWV
WLPLQJFKDUDFWHULVWLFV
6XJJHVWHG0HWKRGRORJ\DQGWRROV+DUGZDUHGHVFULSWLRQODQJXDJHOLNHYHULORJ
9+'/FDQEHXVHGIRUVLPXODWLRQ
7KHH[HUFLVHVKDOOLQYROYHGHVLJQRIGDWDSDWKLWVVLPXODWLRQDQGILQDOO\UHDOL]DWLRQRQ
EUHDGERDUG/LEUDU\RIGLJLWDO,&VKDYHWREHEXLOW6LPLODUO\PDQXDOVRI'LJLWDO,&
IDPLOLHVKDYHWREHSODFHGLQWKHODERUDWRULHVIRUUHIHUHQFHE\VWXGHQWV
6XJJHVWHG([HUFLVHV
x &UHDWHDPLFURSURFHVVRUIURP$/8)RUWKLVWKHVWXGHQWVPD\GHVLJQD
VPDOOLQVWUXFWLRQVHWDQGDWWDFKQHFHVVDU\UHJLVWHUVDQGVXLWDEOHFRQWUROXQLWWR
UHDOL]HDPLFURSURFHVVRU
x 6LPXODWHDQGUHDOL]HD&RUGLFFDOFXODWRU
x 6LPXODWHUHDOL]HD)RXUELW$GGHU
R 'HVLJQDQGVLPXODWLRQRIDELW$GGHU
R 9+'/YHULORJ+'/+DUGZDUHGHVFULSWLRQODQJXDJH
R ,QWHUIDFLQJVHJPHQWGHFRGHU
x &RPELQDWLRQDO0XOWLSOLHU
R [ELWPXOWLSOLHU
R %LQDU\WR%&'FRQYHUVLRQ
R 7LPLQJ&RQVWUDLQWV
x &5&FKHFNVXPJHQHUDWRUYHULILHU
x 5HDOL]LQJDFDUU\ORRNDKHDGDGGHU
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7&20387(51(7:25.6&RPPRQWR&RPS(QJJ,QIR7HFK
&ODVV9,6HP%7HFK
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
%UDQFK,7
0D[LPXP0DUNV 6FKHGXOHSHU:HHN
>0LGWHUP([email protected]
/HFWXUHV
127(7KHILUVWOHFWXUHVVKDOOEHGHYRWHGWRUHYLHZRIWKHEDVLVDUFKLWHFWXUHVDQG
UHVSRQVLELOLWLHVRIGLIIHUHQWOD\HUV
8QLWV
&RQWHQWVRIWKHVXEMHFW
,
,,
,,,
,9
9
1HWZRUN OD\HU 1HWZRUN OD\HU GHVLJQ LVVXH URXWLQJ DOJRULWKPV 2SWLPDOO\
SULQFLSOHVKRUWSDWKIORRGLQJ'LVWDQFHYHFWRUOLQNVWDWHKLHUDUFKLFDO%URDGFDVW
URXWLQJ
&RQJHVWLRQ FRQWURO *HQHUDO SULQFLSOH RI FRQJHVWLRQ FRQWURO FRQJHVWLRQ
SUHYHQWLRQSROLFLHVFRQJHVWLRQFRQWUROLQ'DWDJUDPVXEQHWVORDGVKHGGLQJMLWWHU
FRQWURO
4XDOLW\RIVHUYLFHUHTXLUHPHQWVDQGWHFKQLTXHV
,QWHUQHWZRUNLQJ 'LIIHUHQFHV LQ QHWZRUNV FRQQHFWLQJ QHWZRUNV FRQFDWHQDWHG
YLUWXDOFLUFXLWFRQQHFWLRQOHVVLQWHUQHWZRUNLQJ7XQQHOLQJ,QWHUQHWZRUNURXWLQJ
)UDJPHQWDWLRQ
1HWZRUNOD\HULQWKH,QWHUQHW,39,3DGGUHVVLQJLQFOXGLQJ6XEQHWDGGUHVVLQJ
&,'5 1$7 ,&03 263) %*3 ,*03 $53 5$53 %2273 '+&3RQO\
ZRUNLQJDQGSXUSRVHSDFNHWKHDGHUVHWFQRWLQFOXGHG'LIIHUHQFHVLQ,39RYHU
,39
7UDQVSRUWOD\HU6HUYLFHVSURYLGHG7UDQVSRUWVHUYLFHSULPLWLYHV
(OHPHQWV RI 7UDQVSRUW SURWRFROV DGGUHVVLQJ FRQQHFWLRQ (VWDEOLVKPHQW
FRQQHFWLRQ UHOHDVH )ORZ FRQWURO %XIIHULQJ 0XOWLSOH[LQJ &UDVK 5HFRYHU\
8'353&573
3ULQFLSOHV RI 5HOLDEOH 'DWD 7UDQVIHU 5HOLDEOH GDWD WUDQVIHU RYHU D SHUIHFWO\
UHOLDEOHFKDQQHO&KDQQHOZLWKELWHUURUVDQG/RVV\&KDQQHOZLWKELWHUURUV
7UDQVSRUW /D\HULQWKH ,QWHUQHW ,QWURGXFWLRQWR7&37&3 VHUYLFH 0RGHO 7&3
+HDGHU DQG VHJPHQW VWUXFWXUH 7&3 FRQQHFWLRQ HVWDEOLVKPHQW DQG UHOHDVH
WUDQVPLVVLRQSROLF\WLPHUPDQDJHPHQW7UDQVDFWLRQDO7&3
7&3&RQJHVWLRQ&RQWURO)DLUQHVV7&3GHOD\PRGHOLQJ
$SSOLFDWLRQ/D\HU6HUYLFHQHHGV
'RPDLQ 1DPH 6\VWHP 1DPH 6SDFH UHVRXUFH UHFRUG QDPH VHUYHUV UHVROXWLRQ
SURFHVVLQWURGXFWLRQWR'16SRLVRQLQJ
(OHFWURQLF 0DLO $UFKLWHFWXUH DQG VHUYLFHV 0,0( PHVVDJH IRUPDWV 6073
323,0$3
:RUOG:LGH:HE$UFKLWHFWXUHUHVSRQVLELOLWLHVRIFOLHQWDQGVHUYHUVLGHV+773
SHUIRUPDQFHHQKDQFHPHQW
33 )LOH 6KDULQJ &HQWUDOL]HG 'LUHFWRU\ 4XHU\ IORRGLQJ H[SORLWLQJ
KHWHURJHQHLW\
5HIHUHQFHV
7DQHQEDXP&RPSXWHU1HWZRUNWK(G3HDUVRQ
.XURVH&RPSXWHU1HWZRUNLQJUG(G3HDUVRQ
3HWHUVRQ'DYLH&RPSXWHU1HWZRUNVWK(G(/6(9,(5
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7'(6,*1$1'$1$/<6,62)$/*25,7+06&RPPRQWR&RPS(QJJ
,QIR7HFK
&ODVV9,6HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
8QLWV
&RQWHQWVRIWKHVXEMHFW
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
%$&.*5281' 5HYLHZ RI $OJRULWKP &RPSOH[LW\ 2UGHU 1RWDWLRQV GHILQLWLRQV DQG
FDOFXODWLQJFRPSOH[LW\
,
',9,'( $1' &2148(5 0(7+2' %LQDU\ 6HDUFK 0HUJH 6RUW 4XLFN VRUW DQG
VWUDVVHQ
VPDWUL[PXOWLSOLFDWLRQDOJRULWKPV
*5(('<0(7+2'.QDSVDFN3UREOHP-RE6HTXHQFLQJ2SWLPDO0HUJH3DWWHUQVDQG
0LQLPDO6SDQQLQJ7UHHV
,,
,,,
'<1$0,& 352*5$00,1* 0DWUL[ &KDLQ 0XOWLSOLFDWLRQ /RQJHVW &RPPRQ
6XEVHTXHQFHDQG.QDSVDFN3UREOHP
%5$1&+ $1' %281' 7UDYHOLQJ 6DOHVPDQ 3UREOHP DQG /RZHU %RXQG 7KHRU\
%DFNWUDFNLQJ$OJRULWKPVDQGTXHHQVSUREOHP
3$77(51 0$7&+,1* $/*25,7+06 1DwYH DQG 5DELQ .DUS VWULQJ PDWFKLQJ
DOJRULWKPV.030DWFKHUDQG%R\HU0RRUH$OJRULWKPV
$66,*10(17 352%/(06 )RUPXODWLRQ RI $VVLJQPHQW DQG 4XDGUDWLF $VVLJQPHQW
3UREOHP
,9
5$1'20,=(' $/*25,7+06 /DV 9HJDV DOJRULWKPV 0RQWH &DUOR DOJRULWKPV
UDQGRPL]HGDOJRULWKPIRU0LQ&XWUDQGRPL]HGDOJRULWKPIRU6$73UREOHPGHILQLWLRQ
RI 0XOWLFRPPRGLW\ IORZ )ORZ VKRS VFKHGXOLQJ DQG 1HWZRUN FDSDFLW\ DVVLJQPHQW
SUREOHPV
9
352%/(0 &/$66(6 13 13+$5' $1' 13&203/(7( 'HILQLWLRQV RI 3 13
+DUG DQG 13&RPSOHWH 3UREOHPV 'HFLVLRQ 3UREOHPV &RRN
V 7KHRUHP 3URYLQJ 13
&RPSOHWH3UREOHPV6DWLVILDELOLW\SUREOHPDQG9HUWH[&RYHU3UREOHP$SSUR[LPDWLRQ
$OJRULWKPVIRU9HUWH[&RYHUDQG6HW&RYHU3UREOHP
5HIHUHQFHV
&RUPHQ/HLVHUVRQ5LYHVW,QWURGXFWLRQWR$OJRULWKPV3UHQWLFH+DOORI,QGLD
+RURZLW]DQG6DKDQL)XQGDPHQWDORI&RPSXWHUDOJRULWKPV
$KR$9-'8OPDQ'HVLJQDQGDQDO\VLVRI$OJRULWKPV$GGLVRQ:HVOH\
%UDVVDUG)XQGDPHQWDORI$OJRULWKPLFV3+,
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,77+(25<2)&20387$7,21&RPPRQWR&RPS(QJJ,QIR7HFK
&ODVV9,6HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV7XWRULDO
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
8QLWV
&RQWHQWVRIWKHVXEMHFW
,
)LQLWH $XWRPDWD 5HJXODU ([SUHVVLRQ %DVLF &RQFHSWV RI ILQLWH VWDWH V\VWHP
'HWHUPLQLVWLF DQG QRQGHWHUPLQLVWLF ILQLWH DXWRPDWLRQ DQG GHVLJQLQJ UHJXODU
H[SUHVVLRQV UHODWLRQVKLS EHWZHHQ UHJXODU H[SUHVVLRQ )LQLWH DXWRPDWD
PLQLPL]DWLRQRIILQLWHDXWRPDWLRQPHDO\0RRUH0DFKLQHV
,,
5HJXODU 6HWV RI 5HJXODU *UDPPDUV %DVLF 'HILQLWLRQ RI )RUPDO /DQJXDJH DQG
*UDPPDUV 5HJXODU 6HWV DQG 5HJXODU *UDPPDUV FORVXUH SURSRUWLRQ RI UHJXODU
VHWV 3XPSLQJ OHPPD IRU UHJXODU VHWV GHFLVLRQ $OJRULWKPV IRU UHJXODU VHWV
0\KHOOB1HURG7KHRU\2UJDQL]DWLRQRI)LQLWH$XWRPDWD
,,,
&RQWH[W )UHH /DQJXDJHV 3XVKGRZQ $XWRPDWD &RQWH[W )UHH *UDPPDUV ±
'HULYDWLRQV DQG /DQJXDJHV ± 5HODWLRQVKLS EHWZHHQ GHULYDWLRQ DQG GHULYDWLRQ
WUHHV±DPELJXLW\±VLPSOLILFDWLRQRI&(*±*UHLEDFN1RUPDOIRUP±&KRPVN\
QRUPDO IRUPV ± 3UREOHPV UHODWHG WR &1) DQG *1) 3XVKGRZQ $XWRPDWD
'HILQLWLRQV ± 0RYHV ± ,QVWDQWDQHRXV GHVFULSWLRQV ± 'HWHUPLQLVWLF SXVKGRZQ
DXWRPDWD ± 3XVKGRZQ DXWRPDWD DQG &)/ SXPSLQJ OHPPD IRU &)/ $SSOLFDWLRQVRISXPSLQJ/HPPD
,9
7XULQJ 0DFKLQHV 7XULQJ PDFKLQHV ± &RPSXWDEOH /DQJXDJHV DQG IXQFWLRQV ±
7XULQJ 0DFKLQH FRQVWUXFWLRQV ± 6WRUDJH LQ ILQLWH FRQWURO ± PXOWLSOH WUDFNV ±
FKHFNLQJ RI V\PEROV ± VXEURXWLQHV ± WZR ZD\ LQILQLWH WDSH 8QGHFLGDELOLW\
3URSHUWLHV RI UHFXUVLYH DQG 5HFXUVLYHO\ HQXPHUDEOH ODQJXDJHV ± 8QLYHUVDO
7XULQJ 0DFKLQHV DV DQ XQGHFLGDEOH SUREOHP ± 8QLYHUVDO /DQJXDJHV ± 5LFH¶V
7KHRUHPV
9
/LQHDU ERXQGHG $XWRPDWD &RQWH[W 6HQVLWLYH /DQJXDJH &KRPVN\ +LHUDUFK\ RI
/DQJXDJHV DQG DXWRPDWD %DVLF 'HILQLWLRQ GHVFULSWLRQV RI 7KHRU\ 2UJDQL]DWLRQ RI /LQHDU ERXQGHG $XWRPDWD 3URSHUWLHV RI FRQWH[WVHQVLWLYH
ODQJXDJHV
5HIHUHQFHV
$KR+RSFURSWDQG8OOPDQ,QWURGXFWLRQWR$XWRPDWD7KHRU\)RUPDO/DQJXDJHVDQG
&RPSXWDWLRQ1DURVD
&RKHQ,QWURGXFWLRQWR&RPSXWHU7KHRU\$GGLVRQ:HVOH\
3DSDGLPLWULRX,QWURGXFWLRQWR7KHRU\RI&RPSXWLQJ3UHQWLFH+DOO
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7352*5$00,1*,1-$9$&RPPRQWR&RPS(QJJ,QIR7HFK
&ODVV9,6HP%7HFK
(YDOXDWLRQ
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
8QLWV
&RQWHQWVRIWKHVXEMHFW
-$9$ ,QWURGXFWLRQ WR 2EMHFW 2ULHQWDWHG 3URJUDPPLQJ $EVWUDFWLRQ 2EMHFW
2ULHQWHG3URJUDPPLQJ3ULQFLSOHV )HDWXUHVRI-$9$,QWURGXFWLRQWR -DYDE\WH
FRGH-DYD9LUWXDOPDFKLQH
,
352*5$0 (/(0(176 3ULPLWLYH GDWD W\SHV YDULDEOHV DVVLJQPHQW
DULWKPHWLF VKRUW FLUFXLW ORJLFDO RSHUDWRUV $ULWKPHWLF RSHUDWRUV ELW ZLVH
RSHUDWRUV UHODWLRQDO RSHUDWRUV %RROHDQ ORJLF RSHUDWRUV WKH DVVLJQPHQW
RSHUDWRUVRSHUDWRUSUHFHGHQFH'HFLVLRQDQGFRQWUROVWDWHPHQWVDUUD\V
&21752/ 67$7(0(176 -DYD¶V 6HOHFWLRQ 6WDWHPHQWV LI VWDWHPHQW VZLWFK
VWDWHPHQW ,WHUDWLRQ 6WDWHPHQWV ZKLOH GRZKLOH IRU IRUHDFK 1HVWHG /RRSV
-XPS6WDWHPHQWV8VLQJEUHDN8VLQJFRQWLQXHUHWXUQ
,,
,,,
2%-(&76$1'&/$66(62EMHFWVFRQVWUXFWRUVUHWXUQLQJDQGSDVVLQJREMHFWV
DV SDUDPHWHU 1HVWHG DQG LQQHU FODVVHV 6LQJOH DQG 0XOWLOHYHO ,QKHULWDQFH
([WHQGHG FODVVHV $FFHVV &RQWURO XVDJH RI VXSHU 2YHUORDGLQJ DQG RYHUULGLQJ
PHWKRGV$EVWUDFWFODVVHV8VLQJILQDOZLWKLQKHULWDQFH
3$&.$*($1' ,17(5)$&(6 'HILQLQJSDFNDJH FRQFHSWRI&/$663$7+
DFFHVVPRGLILHUVLPSRUWLQJSDFNDJH'HILQLQJDQGLPSOHPHQWLQJLQWHUIDFHV
675,1* +$1'/,1* 6WULQJ FRQVWUXFWRUV VSHFLDO VWULQJ RSHUDWLRQV FKDUDFWHU
H[WUDFWLRQVHDUFKLQJDQGFRPSDULQJVWULQJVVWULQJ%XIIHUFODVV
,9
(;&(37,21+$1'/,1*([FHSWLRQKDQGOLQJIXQGDPHQWDOV([FHSWLRQW\SHV
XQFDXJKW H[FHSWLRQV WU\ FDWFK DQG PXOWLSOH FDWFK VWDWHPHQWV 8VDJH RI WKURZ
WKURZVDQGILQDOO\),/(+$1'/,1*,2VWUHDPV)LOH,2
9
&21&855(1&< 3URFHVVHV DQG 7KUHDGV 7KUHDG 2EMHFWV 'HILQLQJ DQG
6WDUWLQJ D 7KUHDG 3DXVLQJ ([HFXWLRQ ZLWK 6OHHS ,QWHUUXSWV -RLQV
6\QFKURQL]DWLRQ $33/(7 $SSOHW )XQGDPHQWDOV XVLQJ SDLQW PHWKRG DQG
GUDZLQJSRO\JRQV
5HIHUHQFHV
+HUEHUW6FKLOGW-$9$7KH&RPSOHWH5HIHUHQFH70+'HOKL
'HLWHO+RZWR3URJUDP-$9$3+,
8.&KDNUDERUW\DQG'*'DVWLGDU6RIWZDUHDQG6\VWHPV±$Q,QWURGXFWLRQ:KHHOHU
3XEOLVKLQJ'HOKL
-RVHSK2
1HLODQG+HUE6FKLOGW7HDFK<RXUVHOI-$9$70+'HOKL
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7,1)250$7,217+(25<&2',1*,QIR7HFK
&ODVV9,6HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
8QLWV
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
&RQWHQWVRIWKHVXEMHFW
,
,QWURGXFWLRQ WR LQIRUPDWLRQ WKHRU\ 8QFHUWDLQW\ ,QIRUPDWLRQ DQG (QWURS\
,QIRUPDWLRQPHDVXUHVIRUFRQWLQXRXVUDQGRPYDULDEOHVVRXUFHFRGLQJWKHRUHP
'LVFUHWH0HPRU\OHVVFKDQQHOV0XWXDOLQIRUPDWLRQ&RQGLWLRQDOHQWURS\
,,
6RXUFH FRGLQJ VFKHPHV IRU GDWD FRPSDFWLRQ 3UHIL[ FRGH +XIIPDQ FRGH
6KDQRQ)DQH FRGH +HPSHO=LY FRGLQJ FKDQQHO FDSDFLW\ &KDQQHO FRGLQJ
WKHRUHP6KDQQRQOLPLW
,,,
/LQHDU%ORFN&RGH ,QWURGXFWLRQWRHUURUFRQQHFWLQJ FRGHV FRGLQJGHFRGLQJ
RI OLQHDU EORFN FRGH PLQLPXP GLVWDQFH FRQVLGHUDWLRQ FRQYHUVLRQ RI QRQ
V\VWHPDWLFIRUPRIPDWULFHVLQWRV\VWHPDWLFIRUP
,9
&\FOLF &RGH &RGH $OJHEUD %DVLF SURSHUWLHV RI *DORLV ILHOGV *) SRO\QRPLDO
RSHUDWLRQVRYHU *DORLVILHOGVJHQHUDWLQJF\FOLFFRGH E\JHQHUDWLQJSRO\QRPLDO
SDULW\FKHFNSRO\QRPLDO(QFRGHUGHFRGHUIRUF\FOLFFRGHV
9
&RQYROXWLRQDO&RGH&RQYROXWLRQDOHQFRGHUVRIGLIIHUHQWUDWHV&RGH7UHH7UOOLV
DQG VWDWH GLDJUDP 0D[LPXP OLNHOLKRRG GHFRGLQJ RI FRQYROXWLRQDO FRGH 7KH
YLWHUEL$OJRULWKPIHHGLVWDQFHRIDFRQYROXWLRQDOFRGH
5HIHUHQFHV
'LJLWDO&RPPXQLFDWLRQ6LPRQ+D\NLQ
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7$'9$1&(723,&6,123(5$7,1*6<67(06&RPPRQWR&RPS(QJJ
,QIR
&ODVV9,6HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
7HFK
8QLWV
QLWV
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
&RQWHQWVRIWKHVXEMHFW
&RQWHQWVRIWKHVXEMHFW
2SHUDWLQJ V\VWHP VWUXFWXUHV
VWUXFWXUHV ± SROLFLHV PHFKDQLVP 6WUXFWXUHV PRQROLWKLF
OD\HUHG YLUWXDO PDFKLQHV PLFUR NHUQHO H[RNHUQHOV FOLHQW VHUYHU PRGHO
([DPSOHVIURP/LQX[:LQGRZV
,
7KUHDGV
7KUHDGV $GYDQFH &RQFHSWV±
&RQFHSWV /LEUDULHV 3WKUHDGV ZLQ WKUHDGV -DYD WKUHDGV
,QWURGXFWLRQ WR WKUHDGLQJ LVVXHV V\VWHP FDOOV FDQFHOODWLRQ VLJQDO KDQGOLQJ
WKUHDG SRRO WKUHDG VSHFLILF GDWD ZLQGRZ WKUHDGV /LQX[ WKUHDGV 6RODULV
7KUHDGV
0DVVDJH 3DVVLQJ 6\VWHP
6\VWHP ± 1HHG RI 0HVVDJH 3DVVLQJ 6\VWHPV GHVLJQ LVVXHV
QDPLQJ V\QFKURQL]DWLRQ ,PSOHPHQWDWLRQ±EXIIHULQJ DQG GHOLYHU\ PDLOER[HV
53&50,([DPSOHV6\VWHPV±/LQX[:LQGRZV
)LOH 6\VWHP
6\VWHP ILOH V\VWHP OD\RXWV ILOH V\VWHP LPSOHPHQWDWLRQ FRQWDJLRXV
DOORFDWLRQ OLQN OLVW DOORFDWLRQ LQGH[HG DOORFDWLRQ ILOH DOORFDWLRQ WDEOH YLUWXDO
ILOH V\VWHP GLUHFWRU\ LPSOHPHQWDWLRQ OLQHDU OLVW DQG KDVK WDEOH )LOH 6\VWHP
UHOLDELOLW\DQGLQWHJULW\
,,
,2V\VWHPGHYLFHGULYHUVFRQWUROOHUVEXVVHVDQGLQWHUIDFHV86%,'(
6&6,
,2V\VWHP
,((( 5$,' V\VWHP GLVN FDFKLQJ DQG EXIIHULQJ GLVN PDQDJHPHQWGLVN
IRUPDWWLQJ5$,'6WUXFWXUHERRWEORFNEDGEORFNVZDSVSDFHPDQDJHPHQW
6\VWHP6HFXULW\6HFXULW\3UREOHPV3URJUDP7KUHDWV6\VWHP1HWZRUN7KUHDWV
6\VWHP6HFXULW\
&U\SWRJUDSK\DVD6HFXULW\7RRO8VHU$XWKHQWLFDWLRQ,PSOHPHQWLQJ6HFXULW\
'HIHQVHV )LUHZDOOLQJ WR 3URWHFW 6\VWHPV DQG 1HWZRUN &RPSXWHU 6HFXULW\
&ODVVLILFDWLRQV2YHUYLHZRIVHFXULW\LQ:LQGRZV>@
,,,
7KH/LQX[268QL[9V/LQX['HVLJQ3ULQFLSOHV.HUQHO6WUXFWXUHFRPSRQHQWV
7KH/LQX[26
.HUQHO 0RGXOHV 6KHOO XVDJH W\SHV $Q RYHUYLHZ RI 3URFHVV 0DQDJHPHQW
7KUHDG 0DQDJHPHQW DQG 6FKHGXOLQJ 0HPRU\ 0DQDJHPHQW 3URFHVV
6FKHGXOLQJ LQ /LQX[ )LOH 6\VWHP VWUXFWXUH LPSOHPHQWDWLRQ ,2
0DQDJHPHQW 1HWZRUN )LOH 6\VWHP ,QWHUSURFHVV &RPPXQLFDWLRQV %RRWLQJ
DQGORJLQSURFHVVVHFXULW\>@
,9
7KH :LQGRZ 26 'HVLJQ 3ULQFLSOHV 6\VWHP &RPSRQHQWV +DUGZDUH
$EVWUDFWLRQ OD\HU .HUQHO ([HFXWLYHV (QYLURQPHQWDO 6XEV\VWHPV 06'26
(QYLURQPHQW ELW :LQGRZV (QYLURQPHQW :LQ $3, 326,; VXEV\VWHP
([FHSWLRQ DQG ,QWHUUXSWV $Q RYHUYLHZ RIPHPRU\ PDQDJHPHQW SURFHVV
PDQDJHPHQW DQG WKUHDG 3URFHVV 6FKHGXOLQJ LQ :LQGRZV )LOH 6\VWHPV
,QWHUQDO/D\RXWUHFRYHU\9ROXPH0DQDJHPHQWDQG)DXOW7ROHUDQFH)$7DQG
17)66HFXULW\IHDWXUHVZLQGRZUHJLVWU\26RUJDQL]DWLRQV>@
9
0XOWLSURFHVVRU
6\VWHPV $UFKLWHFWXUH RI 0XOWLSURFHVVRU 6\VWHPV
0XOWLSURFHVVRU 2SHUDWLQJ 6\VWHPV
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
2YHUYLHZRI0XOWLSURFHVVRU26.HUQDO6WUXFWXUHDQG0XOWLSURFHVVLQJVXSSRUW
LQ/LQX[:LQGRZV3URFHVV6\QFKURQL]DWLRQ4XHXHG/RFN6SLQ/RFN6OHHS
/RFN3URFHVV6FKHGXOLQJ
0XOWLPHGLD 2SHUDWLQJ
2SHUDWLQJ 6\VWHP
6\VWHP ,QWURGXFWLRQ WR 0XOWLPHGLD 'DWD
&RPSUHVVLRQ FRQFHSWV FRPPRQ JUDSKLFV ILOH IRUPDWV FRPPRQ DXGLR ILOH
IRUPDWV9LGHRVHUYHU3URFHVVPDQDJHPHQWUHDOWLPHVFKHGXOLQJ0XOWLPHGLD
ILOHV\VWHPV0XOWLPHGLDILOHVWRUDJHPHFKDQLVPV9LGHRVHYHURUJDQL]DWLRQ>@
0RELOH 2SHUDWLQJ 6\VWHP
6\VWHP :LQGRZV &( 3DOP 26 6\PELDQ 26 -$9$ FDUG
0XOWRV
7H[W5HIHUHQFH%RRNV
7H[W5HIHUHQFH%RRNV
'0'KDPGKHUH2SHUDWLQJ6\VWHPV±$&RQFHSWV%DVHG$SSURDFK7DWD0F*UDZ+LOO
$FK\XW6*RGEROH2SHUDWLQJ6\VWHPV7DWD0F*UDZ+LOO
7DQHQEDXP0RGHUQ2SHUDWLQJ6\VWHP3UHQWLFH+DOO
$6LOEHUVFKDW]DQG3HWHU%*DOYLQ2SHUDWLQJ6\VWHP3ULQFLSDOV:LOH\,QGLD3YW/WG
&KDUOHV&URZO\2SHUDWLQJ6\VWHP$'HVLJQ±2ULHQWHG$SSURDFK7DWD0F*UDZ+LOO
%DFK'HVLJQRI8QL[2SHUDWLQJ6\VWHPV
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7%,2,1)250$7,&6,QIR7HFK
&ODVV9,6HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
8QLWV
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
&RQWHQWVRIWKHVXEMHFW
,
3ULQFLSOHVRIPDVVDQGHQHUJ\FRQVHUYDWLRQ7KHUPRG\QDPLFSURSHUWLHVRISXUH
VXEVWDQFHV (TXDWLRQV RI VWDWH &RUUHODWLRQV IRU SK\VLFDO DQG WUDQVSRUW
SURSHUWLHV 0DWHULDO DQG HQHUJ\ EDODQFHV IRU VWHDG\ VWDWH SURFHVVHV LQYROYLQJ
VLQJOHDQGPXOWLSKDVHV\VWHPV5HDFWLYHDQGQRQUHDFWLYHSURFHVVHV
,,
(QHUJ\IORZLQELRORJLFDOV\VWHPV(QHUJHWLFRIPHWDEROLFSDWKZD\V&RXSOHG
UHDFWLRQVPLFURELDOJURZWKNLQHWLFV6WRLFKLRPHWU\DQGHQHUJHWLFDQDO\VLVRIFHOO
JURZWK DQG SURGXFW IRUPDWLRQ <LHOG DQG PDLQWHQDQFH FRHIILFLHQWV 2[\JHQ
FRQVXPSWLRQDQGKHDWHYROXWLRQLQDHURELFFXOWXUHV7KHUPRG\QDPLFHIILFLHQF\
RIJURZWK
,,,
,QWURGXFWLRQ WR IHUPHQWDWLRQ 'HVLJQ RI D DQ LQGXVWULDO IHUPHQWHG 3URFHVV
FDOFXODWLRQV IRU GHVLJQ RI W\SLFDO LQGXVWULDO IHUPHQWDWLRQ SURFHVVHV 0HGLXP
IRUPXODWLRQ %DWFK DQG FRQWLQXRXV KHDW VWHULOLVDWLRQ RI OLTXLG PHGLD
5HTXLUHPHQWV IRU SURFHVV XWLOLWLHV FRPSUHVVHG DLU FRROLQJ ZDWHU VWHDP HWF
0DWHULDO DQG HQHUJ\ EDODQFHV IRU GRZQVWUHDP SURFHVVLQJ DQG ZDVWH ZDWHU
WUHDWPHQWSURFHVVHV%LRUHPHGLDWLRQ
,9
,QWURGXFWLRQ WR LQGXVWULDO ELRSURFHVV $ KLVWRULFDO RYHUYLHZ RI LQGXVWULDO
IHUPHQWDWLRQ SURFHVVHV DQG SURGXFWV 5ROH RI D ELRSURFHVV HQJLQHHU LQ WKH
ELRWHFKQRORJ\ LQGXVWU\ 2XWOLQH RI WKH YDULRXV XQLW RSHUDWLRQV LQYROYHG LQ DQ
LQWHJUDWHG ELRSURFHVV 3URFHVV IORZ VKHHWLQJ $ EULHI VXUYH\ RI RUJDQLVPV
SURFHVVHV SURGXFWV DQG PDUNHW HFRQRPLFV UHODWLQJ WR PRGHUQ LQGXVWULDO ELR
WHFKQRORJ\
5DZ PDWHULDOV IRU IHUPHQWDWLRQ SURFHVV ,VRODWLRQ SUHVHUYDWLRQ DQG
LPSURYHPHQW RI LQGXVWULDO PLFURRUJDQLVPV IRU RYHUSURGXFWLRQ RI SULPDU\ DQG
VHFRQGDU\ PHWDEROLWHV 0HGLXP UHTXLUHPHQWV IRU IHUPHQWDWLRQ SURFHVV FDUERQ
QLWURJHQ PLQHUDOV YLWDPLQV DQG RWKHU QXWULHQWV ([DPSOHV RI VLPSOH DQG
FRPSOH[PHGLD
3URGXFWLRQ RI SULPDU\ PHWDEROLWHV $ EULHI RXWOLQH RI SURFHVVHV IRU WKH
SURGXFWLRQ RI VRPH FRPPHUFLDOO\ LPSRUWDQW RUJDQLF DFLGV HJ FLWULF DFLG
LWDFRQLFDFLGODFWLFDFLGDFHWLFDFLGJOXFRQLFDFLGHWFDPLQRDFLGVJOXWDPLF
DFLG O\VLQH DVSDUWLF DFLG SKHQ\ODODQLQH HWF DQG DOFRKROV HWKDQRO EXWDQHGLROHWF
3URGXFWLRQRIVHFRQGDU\PHWDEROLWHV6WXG\RISURGXFWLRQSURFHVVHVIRUYDULRXV
FODVVHVRIORZPROHFXODUZHLJKWVHFRQGDU\PHWDEROLWHV$QWLELRWLFVEHWDODFWDPV
SHQLFLOOLQV FHSKDORVSRULQV HWF DPLQRJO\FRVLGHV VWUHSWRP\FLQ NDQDP\FLQ
HWFPDFUROLGHVHU\WKURP\FLQTXLQLQHVDURPDWLFVHWF9LWDPLQVDQGVWHURLGV
9
3URGXFWLRQ RI FRPPHUFLDOO\ LPSRUWDQW HQ]\PHV DQG UHFRPELQDQW SURWHLQV
3URWHDVHV DP\ODVHV OLSDVHV FHOOXODVHV SHFWLQDVHV LVRPHUDVHV DQG RWKHU
FRPPHUFLDOO\ LPSRUWDQW HQ]\PHV IRU WKH IRRG DQG SKDUPDFHXWLFDO LQGXVWULHV
3URGXFWLRQ RI UHFRPELQDQW SRWHLQV KDYLQJ WKHUDSHXWLF DQG GLDJQRVWLF
DSSOLFDWLRQV3URGXFWLRQRIYDFFLQHV
5HIHUHQFHV
%U\DQ%HUJHUVRQ%LRLQIRUPDWLFV&RPSXWLQJ3HDUVRQ(GXFDWLRQ
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
3LHUUH%DOGL%LRLQIRUPDWLFV7KH0DFKLQH/HDUQLQJ$SSURDFK6HFRQG(GLWLRQ$GDSWLYH
&RPSXWDWLRQDQG0DFKLQH/HDUQLQJ0,73UHVV
'DYLG:0RXQW%LRLQIRUPDWLFV6HTXHQFHDQG*HQRPH$QDO\VLV&ROG6SULQJ+DUERU
/DERUDWRU\
:DUUHQ-(ZHQV*UHJRU\5*UDQW6WDWLVWLFDO0HWKRGVLQ%LRLQIRUPDWLFV6SULQJHU
9HUODJ
$QGUHDV'%D[HYDQLV%))UDQFLV2XHOOHWWH%LRLQIRUPDWLFV$3UDFWLFDO*XLGHWRWKH
$QDO\VLVRI*HQHVDQG3URWHLQV:LOH\,QWHUVFLHQFH
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7+80$1&20387(5,17(5)$&(&RPPRQWR&RPS(QJJ,QIR7HFK
&ODVV9,6HP%7HFK
%UDQFK,7
6FKHGXOHSHU:HHN
/HFWXUHV
8QLWV
,
,,
,,,
,9
9
(YDOXDWLRQ
([DPLQDWLRQ7LPH 7KUHH+RXUV
0D[LPXP0DUNV >0LGWHUP([email protected]
&RQWHQWVRIWKHVXEMHFW
7KH +XPDQ LQSXWRXWSXW FKDQQHOV +XPDQ PHPRU\ WKLQNLQJ HPRWLRQV
LQGLYLGXDOGLIIHUHQFHVSV\FKRORJ\DQGWKHGHVLJQRILQWHUDFWLYHV\VWHPV
7KH &RPSXWHU 7H[W HQWU\ GHYLFHV ZLWK IRFXV RQ WKH GHVLJQ RI NH\ ERDUGV
SRVLWLRQLQJSRLQWLQJDQGGUDZLQJGLVSOD\GHYLFHV
7KH ,QWHUDFWLRQ 0RGHOV RI LQWHUDFWLRQ HUJRQRPLFV LQWHUDFWLRQ VW\OHV HOHPHQWV
RI:,03LQWHUIDFHVLQWHUDFWLYLW\H[SHULHQFHHQJDJHPHQWDQGIXQ
3DUDGLJPVIRU,QWHUDFWLRQ
'HVLJQ3URFHVV7KHSURFHVVRIGHVLJQXVHUIRFXVVFHQDULRVQDYLJDWLRQGHVLJQ
VFUHHQGHVLJQDQGOD\RXWLWHUDWLRQSURWRW\SLQJ
8VDELOLW\(QJLQHHULQJ
'HVLJQ UXOHV 3ULQFLSOHV WR VXSSRUW XVDELOLW\ VWDQGDUGV JXLGHOLQHV UXOHV DQG
KHXULVWLFV+&,SDWWHUQV
(YDOXDWLRQ 7HFKQLTXHV 'HILQLWLRQ DQG JRDOV RI HYDOXDWLRQ HYDOXDWLRQ WKURXJK
H[SHUWDQDO\VLVDQGXVHUSDUWLFLSDWLRQFKRRVLQJDQHYDOXDWLRQPHWKRG
8VHU VXSSRUW UHTXLUHPHQW DSSURDFKHV DGDSWLYH KHOS V\VWHPV GHVLJQLQJ XVHU
VXSSRUWV\VWHPV
&RJQLWLYH PHWKRGV*RDOV DQGWDVNKLHUDUFKLHVOLQJXLVWLFPRGHOVFKDOOHQJHVRI
GLVSOD\EDVHGV\VWHPVSK\VLFDODQGGHYLFHPRGHOVFRJQLWLYHDUFKLWHFWXUHV
&RPPXQLFDWLRQV DQG FROODERUDWLRQV PRGHOV )DFH WR )DFH FRPPXQLFDWLRQ
FRQYHUVDWLRQV7H[WEDVHGFRPPXQLFDWLRQJURXSZRUNLQJ
7DVN $QDO\VLV 'LIIHUHQFHV EHWZHHQ WDVN DQDO\VLV DQG RWKHU WHFKQLTXHV WDVN
GHFRPSRVLWLRQ NQRZOHGJH EDVHG DQDO\VLV (5 EDVHG DQDO\VLV VRXUFHV RI
LQIRUPDWLRQDQGGDWDFROOHFWLRQXVHRIWDVNDQDO\VLV
5HIHUHQFHV
+XPDQ&RPSXWHU,QWHUDFWLRQ$ODQ'L[HWDOUGHG3HDUVRQ
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7-$9$352*5$00,1*/$%,QIR7HFK
&ODVV9,6HP%7HFK
(YDOXDWLRQ
%UDQFK,7
6FKHGXOHSHU:HHN
3UDFWLFDO+UV
([DPLQDWLRQ7LPH )LYH+RXUV
0D[LPXP0DUNV >6HVVLRQDO0LGWHUP(QGWHUP
@
2EMHFWLYHV$WWKHHQGRIWKHVHPHVWHUWKHVWXGHQWVVKRXOGKDYHFOHDUO\XQGHUVWRRGDQG
LPSOHPHQWHGWKHIROORZLQJ
'HYHORS DQ LQ GHSWK XQGHUVWDQGLQJ RI SURJUDPPLQJ LQ -DYD GDWD W\SHV
YDULDEOHVRSHUDWRUVRSHUDWRUSUHFHGHQFH'HFLVLRQDQGFRQWUROVWDWHPHQWVDUUD\V
VZLWFK VWDWHPHQW ,WHUDWLRQ 6WDWHPHQWV -XPS 6WDWHPHQWV 8VLQJ EUHDN 8VLQJ
FRQWLQXHUHWXUQ
:ULWH2EMHFW2ULHQWHGSURJUDPVLQ-DYD2EMHFWV&ODVVHVFRQVWUXFWRUVUHWXUQLQJ
DQG SDVVLQJ REMHFWV DV SDUDPHWHU ,QKHULWDQFH $FFHVV &RQWURO 8VLQJ VXSHU ILQDO
ZLWKLQKHULWDQFH2YHUORDGLQJDQGRYHUULGLQJPHWKRGV$EVWUDFWFODVVHV([WHQGHG
FODVVHV
'HYHORS XQGHUVWDQGLQJ WR GHYHORSLQJ SDFNDJHV ,QWHUIDFHV LQ -DYD 3DFNDJH
FRQFHSW RI &/$663$7+ DFFHVV PRGLILHUV LPSRUWLQJ SDFNDJH 'HILQLQJ DQG
LPSOHPHQWLQJLQWHUIDFHV
'HYHORS XQGHUVWDQGLQJ WR GHYHORSLQJ 6WULQJV DQG H[FHSWLRQ KDQGOLQJ 6WULQJ
FRQVWUXFWRUV VSHFLDO VWULQJ RSHUDWLRQV FKDUDFWHU H[WUDFWLRQ VHDUFKLQJ DQG
FRPSDULQJ VWULQJV VWULQJ %XIIHU FODVV ([FHSWLRQ KDQGOLQJ IXQGDPHQWDOV
([FHSWLRQ W\SHV XQFDXJKW H[FHSWLRQV WU\ FDWFK DQG PXOWLSOH FDWFK VWDWHPHQWV
8VDJHRIWKURZWKURZVDQGILQDOO\
'HYHORSDSSOLFDWLRQVLQYROYLQJILOHKDQGOLQJ
ILOHKDQGOLQJ,2VWUHDPV)LOH,2
ILOHKDQGOLQJ
'HYHORS DSSOLFDWLRQV LQYROYLQJ FRQFXUUHQF\ 3URFHVVHV DQG 7KUHDGV 7KUHDG
2EMHFWV'HILQLQJDQG6WDUWLQJD7KUHDG3DXVLQJ([HFXWLRQZLWK6OHHS,QWHUUXSWV
-RLQVDQG6\QFKURQL]DWLRQ
'HYHORSDSSOLFDWLRQVLQYROYLQJ$SSOHW
$SSOHW$SSOHW)XQGDPHQWDOVXVLQJSDLQWPHWKRG
$SSOHW
DQGGUDZLQJSRO\JRQV
,WLVH[SHFWHGWKDWHDFKODERUDWRU\DVVLJQPHQWVWRJLYHQWRWKHVWXGHQWVZLWKDQDLPWR,Q
RUGHUWRDFKLHYHWKHDERYHREMHFWLYHV
,QGLFDWLYH/LVWRIH[HUFLVHV
3URJUDPV WR GHPRQVWUDWH EDVLF FRQFHSWV HJ RSHUDWRUV FODVVHV FRQVWUXFWRUV
FRQWUROLWHUDWLRQVWDWHPHQWVUHFXUVLRQHWFVXFKDVFRPSOH[ DULWKPHWLFPDWUL[
DULWKPHWLFWRZHURI+DQRLSUREOHPHWF
'HYHORSPHQW RI SURJUDPVSURMHFWV WR GHPRQVWUDWH FRQFHSWV OLNH LQKHULWDQFH
H[FHSWLRQ KDQGOLQJ SDFNDJHV LQWHUIDFHV HWF VXFK DV DSSOLFDWLRQ IRU HOHFWULFLW\
GHSDUWPHQWOLEUDU\PDQDJHPHQWWLFNHWUHVHUYDWLRQV\VWHPSD\UROOV\VWHPHWF
'HYHORSPHQWRIDSURMHFWWRGHPRQVWUDWHYDULRXVILOHKDQGOLQJFRQFHSWV
'HYHORSPHQWRIDSURMHFWWRGHPRQVWUDWHYDULRXVDSSOHWFRQFHSWV
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7*8,'(6,*1/$%,QIR7HFK
&ODVV9,6HP%7HFK
(YDOXDWLRQ
%UDQFK,7
6FKHGXOHSHU:HHN
3UDFWLFDO+UV
([DPLQDWLRQ7LPH )RXU+RXUV
0D[LPXP0DUNV >6HVVLRQDO0LGWHUP(QGWHUP
@
61R
/LVWRI([SHULPHQWV
$GGLQJEXWWRQVHGLWILHOGVDQGRWKHUFKLOGZLQGRZFRPSRQHQWV
,PSOHPHQWWKH&2EMHFWGHEXJJLQJDELOLW\DQG&RPPRQ0)&SUREOHPV
,PSOHPHQW*',)XQFWLRQVDQGWKH&'&FODVV7H[W'UDZLQJVKDSHV
%LWPDSV
,PSOHPHQWLQJ9LHZFODVVIXQFWLRQV
, ,QWHUDFWLQJZLWKWKHXVHU
,, (YHQW+DQGOLQJ
,,, 5HVSRQGLQJWRHYHQWVIURPGLIIHUHQWFRQWUROW\SHV
,PSOHPHQWLQJ9LHZFODVVIXQFWLRQV
, *',)XQFWLRQVDQGWKH&'&FODVV
,, 7H[W
,,, 'UDZLQJVKDSHV
,9 %LWPDSV
,PSOHPHQWLQJ'LDORJ%ORFNFODVV
&UHDWLQJD'LDORJER[
,QYRNLQJDQGGLVSOD\LQJ
6HWWLQJDQGUHWULHYLQJYDOXHVIURPDGLDORJER[
,PSOHPHQWLQJ'LDORJ%R[HV&RPSOHWLRQ'DWDEDVH&ODVVHV
, 2'%&YV'$2
,, 'DWDEDVHVDQG5HFRUGVHWV
,,, 4XHULHVILOWHULQJDQGRUGHULQJ
3ULQWLQJDQG3ULQW3UHYLHZ
, 'DWDEDVHVW\OHUHSRUWV
,,&RPPRQ'LDORJLQWHUIDFH
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,76+(//352*5$00,1*/$%&RPPRQWR&RPS(QJJ,QIR7HFK
&ODVV9,6HP%7HFK
(YDOXDWLRQ
%UDQFK,7
6FKHGXOHSHU:HHN
3UDFWLFDO+UV
61R
([DPLQDWLRQ7LPH )RXU+RXUV
0D[LPXP0DUNV >6HVVLRQDO0LGWHUP(QGWHUP
@
/LVWRI([SHULPHQWV
8VHRI%DVLF8QL[6KHOO&RPPDQGVOVPNGLUUPGLUFGFDWEDQQHUWRXFKILOH
ZFVRUWFXWJUHSGGGIVSDFHGXXOLPLW
&RPPDQGV UHODWHG WR LQRGH ,2 UHGLUHFWLRQ DQG SLSLQJ SURFHVV FRQWURO
FRPPDQGVPDLOV
6KHOO3URJUDPPLQJ6KHOOVFULSWH[HUFLVHVEDVHGRQIROORZLQJ
L ,QWHUDFWLYH VKHOO VFULSWV LL 3RVLWLRQDO SDUDPHWHUV LLL $ULWKPHWLF LY LI
WKHQIL LIWKHQHOVHIL QHVWHG LIHOVH Y /RJLFDO RSHUDWRUV YL HOVH LI HTXDOV
HOLIFDVHVWUXFWXUH
YLLZKLOHXQWLOIRUORRSVXVHRIEUHDNYLLL0HWDFKDUDFWHUV
L[6\VWHPDGPLQLVWUDWLRQGLVNPDQDJHPHQWDQGGDLO\DGPLQLVWUDWLRQ
:ULWHDVKHOOVFULSWWRFUHDWHDILOHLQ86(5FODVVEDWFKGLUHFWRU\)ROORZWKH
LQVWUXFWLRQV
L,QSXWDSDJHSURILOHWR\RXUVHOIFRS\LWLQWRRWKHUH[LVWLQJILOH
LL6WDUWSULQWLQJILOHDWFHUWDLQOLQH
LLL 3ULQW DOO WKH GLIIHUHQFH EHWZHHQ WZR ILOH FRS\ WKH WZR ILOHV DW
86(5&6&GLUHFWRU\
LY3ULQWOLQHVPDWFKLQJFHUWDLQZRUGSDWWHUQ
:ULWHVKHOOVFULSWIRU
L6KRZLQJWKHFRXQWRIXVHUVORJJHGLQ
LL3ULQWLQJ&ROXPQOLVWRIILOHVLQ\RXUKRPHGLUHFWRU\
LLL/LVWLQJ\RXUMREZLWKEHORZQRUPDOSULRULW\
LY&RQWLQXHUXQQLQJ\RXUMREDIWHUORJJLQJRXW
:ULWHDVKHOOVFULSWWRFKDQJHGDWDIRUPDW6KRZWKHWLPHWDNHQLQH[HFXWLRQRI
WKLVVFULSW
:ULWHDVKHOOVFULSWWRSULQWILOHVQDPHVLQDGLUHFWRU\VKRZLQJGDWHRIFUHDWLRQ
VHULDOQXPEHURIWKHILOH
:ULWHDVKHOOVFULSWWRFRXQWOLQHVZRUGVDQGFKDUDFWHUVLQLWVLQSXWGRQRWXVH
ZF
:ULWHDVKHOOVFULSWWRSULQWHQGRID*ORVVDU\ILOHLQUHYHUVHRUGHUXVLQJ$UUD\
8VHDZNWDLO
:ULWH D VKHOO VFULSW WR FKHFN ZKHWKHU 5DP ORJJHG LQ &RQWLQXH FKHFNLQJ
IXUWKHUDIWHUHYHU\VHFRQGVWLOOVXFFHVV
:ULWH D VKHOO VFULSW WR FRPSXWH JFG OFP RI WZR QXPEHUV 8VH WKH EDVLF
IXQFWLRQWRILQGJFGOFPRI1QXPEHUV
:ULWH D VKHOO VFULSW WR ILQG ZKHWKHU D JLYHQ QXPEHU LV SULPH 7DNH D ODUJH
QXPEHUVXFKDVGLJLWVRUKLJKHUDQGXVHDSURSHUDOJRULWKP
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
5HI81,;6KHOOSURJUDPPLQJ%\6WHSKHQ*.RFKDQ3DWULFN+:RRG
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
,7'(6,*1$1'$1$/<6,62)$/*25,7+06&RPPRQWR&RPS
&ODVV9,6HP%7HFK
(YDOXDWLRQ
%UDQFK,7
6FKHGXOHSHU:HHN
3UDFWLFDO+UV
([DPLQDWLRQ7LPH )RXU+RXUV
0D[LPXP0DUNV >6HVVLRQDO0LGWHUP(QGWHUP
@
(QJJ,QIR7HFK
2EMHFWLYHV8SRQVXFFHVVIXOFRPSOHWLRQRIWKLVFRXUVHVWXGHQWVVKRXOGEHDEOHWR
x 3URYHWKHFRUUHFWQHVVDQGDQDO\]HWKHUXQQLQJWLPHRIWKHEDVLFDOJRULWKPV
IRUWKRVHFODVVLFSUREOHPVLQYDULRXVGRPDLQV
x $SSO\WKHDOJRULWKPVDQGGHVLJQWHFKQLTXHVWRVROYHSUREOHPV
x $QDO\]HWKHFRPSOH[LWLHVRIYDULRXVSUREOHPVLQGLIIHUHQWGRPDLQV
6XJJHVWHG7RROV)RULPSOHPHQWDWLRQDQGHVWLPDWLRQRIUXQQLQJWLPHRQYDULRXVVL]HV
RILQSXWVRURXWSXWVDVWKHFDVHPD\EH/LQX[SODWIRUPLVVXJJHVWHG
6XJJHVWHG([HUFLVHV
$ ,WLVH[SHFWHGWKDWWHDFKHUVZLOODVVLJQDOJRULWKPVWRWKHVWXGHQWVIRUHVWLPDWLRQ
RIWLPHVSDFHFRPSOH[LW\$OJRULWKPVUHSRUWHGLQYDULRXVUHVHDUFKMRXUQDOV
PD\EHFKRVHQE\WKHWHDFKHUV
% 3UREOHPRQGHVLJQLQJDOJRULWKPVWRPHHWFRPSOH[LW\FRQVWUDLQWVPD\EH
DVVLJQHG)RUH[DPSOHDSUREOHPRQGHVLJQDQDO\VLVDQGLPSOHPHQWDWLRQIRU
WUDQVSRVLQJDVSDUVHPDWUL[UHTXLULQJQRWPRUHWKDQRQHSDVVIURPWKHRULJLQDO
PDWUL[PD\EHDVVLJQHG
& $JXLGHWRVXFKSUREOHPVLVJLYHQEHORZ
([SORULQJ D %LQDU\ +HDS &RQVLGHU D ELQDU\ KHDS FRQWDLQLQJ Q
QXPEHUV WKH URRW VWRUHV WKH JUHDWHVW QXPEHU <RX DUH JLYHQ D
SRVLWLYHLQWHJHUNQDQGDQXPEHU[<RXKDYHWRGHWHUPLQHZKHWKHU
WKH NWK ODUJHVW HOHPHQW RI WKH KHDS LV JUHDWHU WKDQ [ RU QRW <RXU
DOJRULWKPPXVWWDNH2NWLPH<RXPD\XVH2NH[WUDVWRUDJH
0HUJLQJWZRVHDUFKWUHHV<RXDUHJLYHQWZRKHLJKWEDODQFHGELQDU\
VHDUFK WUHHV 7 DQG 7
VWRULQJ P DQG Q HOHPHQWV UHVSHFWLYHO\ (YHU\
HOHPHQWRIWUHH7LVVPDOOHUWKDQHYHU\HOHPHQWRIWUHH7
(YHU\QRGHX
DOVR VWRUHV KHLJKW RI WKH VXEWUHH URRWHG DW LW 8VLQJ WKLV H[WUD
LQIRUPDWLRQKRZFDQ\RXPHUJHWKHWZRWUHHVLQWLPH2ORJPORJQ
SUHVHUYLQJERWKWKHKHLJKWEDODQFHDQGWKHRUGHU"
&RPSOHWHELQDU\WUHHDVDQHIILFLHQWGDWDVWUXFWXUH
<RX DUH JLYHQ DQ DUUD\ RI VL]H Q Q EHLQJ D SRZHU RI WZR $OO WKH
HQWULHV RI WKH DUUD\ DUH LQLWLDOL]HG WR ]HUR <RX KDYH WR SHUIRUP D
VHTXHQFHRIWKHIROORZLQJRQOLQHRSHUDWLRQV
L$GGL[ZKLFKDGGV[WRWKHHQWU\$>[email protected]
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
LL5HSRUWVXPLM VXPRIWKHHQWULHVLQWKHDUUD\IURPLQGLFHVL
WRMIRUDQ\LM Q
,W FDQ EH VHHQ HDVLO\ WKDW ZH FDQ SHUIRUP WKH ILUVW RSHUDWLRQ LQ 2
WLPHZKHUHDVWKHVHFRQGRSHUDWLRQPD\FRVW2QLQZRUVWFDVH<RXU
REMHFWLYH LV WR SHUIRUP WKHVH RSHUDWLRQV HIILFLHQWO\ *LYH D GDWD
VWUXFWXUHZKLFKZLOOJXDUDQWHH2ORJQWLPHSHURSHUDWLRQ
3UREOHPVRQ$PRUWL]HG$QDO\VLV
D 'HOHWHPLQLQFRQVWDQWWLPH&RQVLGHUDELQDU\KHDSRIVL]HQ
WKHURRWVWRULQJWKHVPDOOHVWHOHPHQW:HNQRZWKDWWKHFRVWRI
LQVHUWLRQRIDQ HOHPHQWLQWKH KHDSLV 2ORJQDQGWKHFRVWRI
GHOHWLQJWKHVPDOOHVWHOHPHQWLVDOVR 2ORJ Q6XJJHVWDYDOLG
SRWHQWLDOIXQFWLRQVRWKDWWKHDPRUWL]HGFRVWRILQVHUWLRQLV2ORJ
QZKHUHDVDPRUWL]HGFRVWRIGHOHWLQJWKHVPDOOHVWHOHPHQWLV2
E ,PSOHPHQWLQJDTXHXHE\WZRVWDFN
F 6KRZ KRZ WR LPSOHPHQW D TXHXH ZLWK WZR RUGLQDU\ VWDFNV VR
WKDW WKH DPRUWL]HG FRVW RI HDFK (QTXHXH DQG HDFK 'HTXHXH
RSHUDWLRQLV2
&RPSXWLQJDVSDQQLQJWUHHKDYLQJVPDOOHVWYDOXHRIODUJHVWHGJH
ZHLJKW'HVFULEHDQHIILFLHQWDOJRULWKPWKDWJLYHQDQXQGLUHFWHGJUDSK
* GHWHUPLQHV D VSDQQLQJ WUHH RI * ZKRVH ODUJHVW HGJH ZHLJKW LV
PLQLPXPRYHUDOOVSDQQLQJWUHHVRI*
6KRUWHVW3DWK3UREOHPV
L )URPDVXEVHWRIYHUWLFHVWRDQRWKHUVXEVHWRIYHUWLFHV
D *LYHQDGLUHFWHGJUDSK*9(ZKHUHHGJHVKDYHQRQQHJDWLYH
ZHLJKWV6DQG'DUHWZRGLVMRLQWVXEVHWVRIWKHVHWRIYHUWLFHV
*LYHDQ2_9_ORJ_9__(_WLPHDOJRULWKPWRILQGWKHVKRUWHVW
SDWKDPRQJWKHVHWRISDWKVSRVVLEOHIURPDQ\QRGHLQ6WRDQ\
QRGHLQ'
LL 3DWKVLQ'LUHFWHG$F\FOLF*UDSK
D &RXQWLQJWKHQXPEHURISDWKV
*LYHQWZRQRGHVXYLQDGLUHFWHGDF\FOLFJUDSK*9(*LYHDQ
2_(_WLPHDOJRULWKPWRFRXQWDOOWKHSDWKVIURPXWRY
E 3DWKSDVVLQJWKURXJKDVXEVHWRIQRGHV
*LYHQWZRQRGHVXYDQGDVHWRIYHUWLFHVZZZNLQD
GLUHFWHGDF\FOLFJUDSK*9(*LYHDQ2_(_WLPHDOJRULWKPWR
RXWSXWDSDWKLIH[LVWVIURPXWRYZKLFKSDVVHVWKURXJKHDFKRI
WKHQRGHVZZN,IWKHUHLVQRVXFKSDWKWKHQ\RXUDOJRULWKP
PXVWUHSRUWWKDWQRVXFKSDWKH[LVWV
6HDUFKLQJIRUDIULHQG
<RXDUHVWDQGLQJDWDFURVVLQJIURPZKHUHWKHUHHPHUJHIRXUURDGV
H[WHQGLQJWRLQILQLW\<RXUIULHQGLVVRPHZKHUHRQRQHRIWKHIRXU
URDGV<RXGRQRWNQRZRQZKLFKURDGKHLVDQGKRZIDUKHLVIURP
\RX<RXKDYHWRZDONWR\RXUIULHQGDQGWKHWRWDOGLVWDQFHWUDYHOHGE\
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
\RXPXVWEHDWPRVWDFRQVWDQWWLPHVWKHDFWXDOGLVWDQFHRI\RXUIULHQG
IURP\RX,QWHUPLQRORJ\RIDOJRULWKPV\RXVKRXOGWUDYHUVH2G
GLVWDQFHZKHUHGLVWKHGLVWDQFHRI\RXUIULHQGIURP\RX
$VLPSOHSUREOHPRQVRUWHGDUUD\'HVLJQDQ2QWLPHDOJRULWKP
WKDWJLYHQDUHDOQXPEHU[DQGDVRUWHGDUUD\6RIQQXPEHUV
GHWHUPLQHVZKHWKHURUQRWWKHUHH[LVWWZRHOHPHQWVLQ6ZKRVHVXPLV
H[DFWO\[
)LQGLQJWKHGHFLPDOGRPLQDQWLQOLQHDUWLPH<RXDUHJLYHQQUHDO
QXPEHUVLQDQDUUD\$QXPEHULQWKHDUUD\LVFDOOHGDGHFLPDO
GRPLQDQWLILWRFFXUVPRUHWKDQQWLPHVLQWKHDUUD\*LYHDQ2Q
WLPHDOJRULWKPWRGHWHUPLQHLIWKHJLYHQDUUD\KDVDGHFLPDOGRPLQDQW
)LQGLQJ WKH ILUVW RQH <RX DUH JLYHQ DQ DUUD\ RI LQILQLWH OHQJWK
FRQWDLQLQJ ]HURV IROORZHG E\ RQHV +RZ IDVW FDQ \RX ORFDWH WKH ILUVW
RQHLQWKHDUUD\"
6HDUFKLQJ IRU WKH &HOHEULW\ &HOHEULW\ LV D SHUVRQ ZKRP HYHU\ERG\
NQRZVEXWKHNQRZVQRERG\<RXKDYHJRQHWRDSDUW\7KHUHDUHWRWDO
QSHUVRQVLQWKHSDUW\<RXUMRELVWRILQGWKHFHOHEULW\LQWKHSDUW\<RX
FDQDVNTXHVWLRQVRIWKHIRUP'RHV0U;NQRZ0U<"<RXZLOOJHWD
ELQDU\ DQVZHU IRU HDFK VXFK TXHVWLRQ DVNHG )LQG WKH FHOHEULW\ E\
DVNLQJRQO\2QTXHVWLRQV
&KHFNLQJ WKH 6FRUSLRQ $Q QYHUWH[ JUDSK LV D VFRUSLRQ LI LW KDV D
YHUWH[RIGHJUHHWKHVWLQJFRQQHFWHGWRDYHUWH[RIGHJUHHWZRWKH
WDLO FRQQHFWHG WR D YHUWH[ RI GHJUHH Q WKH ERG\ FRQQHFWHG WR WKH
RWKHUQWKHIHHW6RPHRIWKHIHHWPD\EHFRQQHFWHGWRRWKHUIHHW
'HVLJQ DQ DOJRULWKP WKDW GHFLGHV ZKHWKHU D JLYHQ DGMDFHQF\ PDWUL[
UHSUHVHQWV D VFRUSLRQ E\ H[DPLQLQJ RQO\ 2Q HQWULHV
(QGOHVVOLVW<RXDUHKDYLQJDSRLQWHUWRWKHKHDGRIVLQJO\OLQNHGOLVW
7KHOLVWHLWKHUWHUPLQDWHVDWQXOOSRLQWHURULWORRSVEDFNWRVRPH
5$-$67+$17(&+1,&$/81,9(56,7<
'HWDLOHG6\OODEXV%7HFK,QIR7HFK99,6HP
SUHYLRXVORFDWLRQQRWQHFHVVDULO\WRWKHKHDGRIWKHOLVW<RXKDYHWR
GHWHUPLQHZKHWKHUWKHOLVWORRSVEDFNRUHQGVDWDQXOOORFDWLRQLQWLPH
SURSRUWLRQDOWRWKHOHQJWKRIWKHOLVW<RXFDQXVHDWPRVWDFRQVWDQW
DPRXQWRIH[WUDVWRUDJH
1HDUHVW&RPPRQ$QFHVWRU
*LYHQ D URRWHG WUHH RI VL]H Q <RX UHFHLYH D VHULHV RI RQOLQH TXHULHV
*LYH QHDUHVW FRPPRQ DQFHVWRU RI X Y <RXU REMHFWLYH LV WR
SUHSURFHVVWKHWUHHLQ2QWLPHWRJHWDGDWDVWUXFWXUHRIVL]H2QVR
WKDW\RXFDQDQVZHUDQ\VXFKTXHU\LQ2ORJQWLPH
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
7IT1 SOFTWARE PROJECT MANAGEMENT (Common to Comp. Engg. & Info. Tech)
Class: VII Sem. B.Tech.
Evaluation
Branch: Info. Tech
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units
I
II
III
IV
V
Contents of the subject
Project Management: The management spectrum, the people, the product, the process,
the project, the W5HH principle, critical practices
Metrics for Process and Project: Metrics in the process and project Domains, software
measurements, metrics for software quality, integrating metrics within software process,
metrics for small organizations, establishing a software metrics program.
Estimation: Observations, Project planning Process, software scope and feasibility,
resources, software project estimation, decomposition techniques, empirical estimation
models, estimation for object oriented projects, estimation for Agile development and
web engineering projects, the make/buy decision.
Project Scheduling: Basic concepts, project scheduling, defining a task set and task
network, scheduling, earned value analysis.
Risk Management: Reactive V/S proactive Risk Strategies, software risks, Risk
identification, Risk projection, risk refinement, risk mitigation, monitoring and
management, the RMMM plan
Quality Planning.: Quality Concepts, Procedural Approach to Quality Management,
Quantitative Approaches to Quality Management, Quantitative Quality Management
Planning, Setting the Quality Goal, Estimating Defects for Other Stages, Quality Process
Planning, Defect Prevention Planning.
Quality Management: Quality Concepts, Software Quality assurances, software reviews,
formal technical reviews, Formal approaches to SQA, Statistical Software Quality
assurances, Change Management: software Configuration Management, The SCM
repository, SCM Process, Configuration Management for Web Engineering
Project Execution And Closure:
Reviews. The Review Process, Planning, Overview and Preparation, Group Review
Meeting, Rework and Follow-up, One-Person Review, Guidelines for Reviews in
Projects, Data Collection, Analysis and Control Guidelines, Introduction of Reviews and
the NAH Syndrome.
Project Monitoring and Control: Project Tracking, Activities Tracking, Defect
Tracking, Issues Tracking, Status Reports, Milestone Analysis, Actual Versus Estimated
Analysis of Effort and Schedule, Monitoring Quality, Risk-Related Monitoring.
Project Closure: Project Closure Analysis, The Role of Closure Analysis, Performing
Closure Analysis.
References:
1. R. S. Pressman, Software Engineering
2. Pankaj Jalote, Software project management in practice, Addison-Wesley
3. B. Hughest & M. Cotterell, Software Project Management.
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
7IT2 WIRELESS COMMUNICATION & NETWORKS (Common to Comp. Engg. & Info.
Tech.)
Class: VII Sem. B.Tech.
Evaluation
Branch: Info. Tech.
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units Contents of the subject
,QWURGXFWLRQ WR :LUHOHVV &RPPXQLFDWLRQ 6\VWHPV
6\VWHPV (YROXWLRQ RI PRELOH 5DGLR &RPPXQLFDWLRQV
$SSOLFDWLRQV RI PRELOH FRPPXQLFDWLRQ 0RELOH 5DGLR 6\VWHPV $URXQG WKH :RUOG ([DPSOH RI
:LUHOHVV &RPPXQLFDWLRQ 6\VWHPV 6HFRQG *HQHUDWLRQ* &HOOXODU 1HWZRUNV 7KLUG
*HQHUDWLRQ* :LUHOHVV 1HWZRUNV )UHTXHQF\ 5HXVH &KDQQHO $VVLJQPHQW 6WUDWHJLHV +DQGRII
6WUDWHJLHV ,QWHUIHUHQFH DQG 6\VWHP &DSDFLW\ ,PSURYLQJ &RYHUDJH DQG &DSDFLW\ LQ &HOOXODU
6\VWHPV>@)UHTXHQFLHVIRUUDGLRWUDQVPLVVLRQUHJXODWLRQV>@
,
,QWURGXFWLRQ WR VLJQDOV DQDORJ GLJLWDO GDWD WUDQVPLVVLRQ WUDQVPLVVLRQ LPSDLUPHQWV HIIHFW RI
PXOWLSDWKSURSDJDWLRQW\SHRIIDGLQJHUURUFRPSHQVDWLRQ>@
0HGLXP DFFHVV FRQWURO
FRQWURO QHHG IRU VSHFLDOL]HG 0$& KLGGHQ DQG H[SRVHG WHUPLQDO QHDU DQG IDU
WHUPLQDOV 0$& VFKHPHV )L[HG 7'0$ $ORKD &60$ '$0$ 350$ UHVHUYDWLRQ 7'0$
0$&$SROOLQJ,60$&'0$6$0$FRPSDULVRQV>@
,,
7HOHFRPPXQLFDWLRQV\VWHPV*60PRELOHVHUYLFHVV\VWHPDUFKLWHFWXUHUDGLRLQWHUIDFHSURWRFROV
7HOHFRPPXQLFDWLRQV\VWHPV
ORFDOL]DWLRQDQGFDOOLQJKDQGRYHUVHFXULW\QHZGDWDVHUYLFHV+6&6'LQWURGXFWLRQWR*356>@
:LUHOHVV /$1
/$1 DGYDQWDJHV GLVDGYDQWDJHV DQG GHVLJQ JRDOV LQIUD UHG YV UDGLR WUDQVPLVVLRQ
LQIUDVWUXFWXUH DQG DGKRF QHWZRUN ,((( 6\VWHP DUFKLWHFWXUH SURWRFRO DUFKLWHFWXUH
SK\VLFDO OD\HU PHGLXP DFFHVV FRQWURO OD\HU 0$& PDQDJHPHQW DQG IXQFWLRQV EULHI LGHD RI EDQHZHUGHYHORSPHQWV>@
,,,
+,3(5/$1
+,3(5/$1 +,3(5/$1 %OXHWRRWK XVHU VFHQDULRV DUFKLWHFWXUH UDGLR OD\HU EDVH EDQG OD\HU
OLQNPDQDJHUSURWRFRO/&$3VHFXULW\6'3SURILOHV,(((>@
0RELOHQHWZRUN
0RELOHQHWZRUN OD\HUPRELOH,3*RDOVDVVXPSWLRQVDQGUHTXLUHPHQWVHQWLWLHVDQGWHUPLQRORJ\
OD\HU
,3 SDFNHWV GHOLYHU\ DJHQW GLVFRYHU\ UHJLVWUDWLRQ WXQQHOLQJ DQG HQFDSVXODWLRQ RSWLPL]DWLRQV
UHYHUVHWXQQHOLQJ'+&3 0RELOH$GKRFQHWZRUN±XVDJHURXWLQJJOREDOVWDWHURXWLQJ*65
'HVWLQDWLRQVHTXHQFHGGLVWDQFHYHFWRUURXWLQJ'6'9'\QDPLFVRXUFHURXWLQJ'65$G+RFRQ
GHPDQGGLVWDQFHYHFWRUURXWLQJ$2'97HPSRUDU\RUGHUHGURXWLQJDOJRULWKP725$>@
,9
0RELOHWUDQVSRUWOD\HU,PSOLFDWLRQVRIPRELOLW\LQ7UDGLWLRQDO7&3FODVVLFDO
7&3LPSURYHPHQWV
0RELOHWUDQVSRUWOD\HU
LQGLUHFW 7&3 VQRRSLQJ 7&3 PRELOH 7&3 IDVW UHWUDQVPLWIDVW UHFRYHU\ WUDQVPLVVLRQWLPHRXW
IUHH]LQJVHOHFWLYHUHWUDQVPLVVLRQWUDQVDFWLRQRULHQWHG7&3>@
6XSSRUWIRUPRELOLW\)LOHV\VWHPV,QWURGXFWLRQWRFRGDOLWWOHZRUN)LFXV0,R1)6URYHU:RUOG
6XSSRUWIRUPRELOLW\
ZLGH ZHE K\SHUWH[W WUDQVIHU SURWRFRO K\SHUWH[W ODQJXDJH V\VWHP DUFKLWHFWXUH :LUHOHVV
$SSOLFDWLRQ 3URWRFRO DUFKLWHFWXUH ZLUHOHVV GDWDJUDP SURWRFRO ZLUHOHVV WUDQVSRUW OD\HU VHFXULW\
ZLUHOHVVWUDQVDFWLRQSURWRFROZLUHOHVVVHVVLRQSURWRFROZLUHOHVVDSSOLFDWLRQHQYLURQPHQWZLUHOHVV
PDUNXS ODQJXDJH :0/ 6FULSW ZLUHOHVV WHOHSKRQ\ DSSOLFDWLRQ SXVK DUFKLWHFWXUH SXVKSXOO
VHUYLFHVH[DPSOHVWDFNVZLWK:$3[>@
9
7H[W%RRNV5HIHUHQFHV
7H[W%RRNV5HIHUHQFHV
0RELOH&RPPXQLFDWLRQV6FKLOOHUQG(G3HDUVRQ
:LUHOHVV&RPPXQLFDWLRQV7KHRGRUH65DSSDSRUWQG(G3+,
:LUHOHVV&RPPXQLFDWLRQV:LOOLDP6WDOOLQJV 3UHQWLFH+DOO
4. :,5(/(66 &20081,&$7,216 1(7:25.,1* 9LMD\ *DUJ 7KH 0RUJDQ .DXIPDQQ 6HULHV
LQ1HWZRUNLQJ
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
7IT3 DATA MINING & WARE HOUSING (Info. Tech.)
Class: VII Sem. B.Tech.
Evaluation
Branch: Info. Tech.
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units
Contents of the subject
,
2YHUYLHZ 0RWLYDWLRQIRU 'DWD 0LQLQJ'DWD 0LQLQJ'HILQLWLRQ )XQFWLRQDOLWLHV
'DWD3URFHVVLQJ)RUPRI'DWD3UHSURFHVVLQJ'DWD &OHDQLQJ0LVVLQJ9DOXHV1RLV\
'DWD %LQQLQJ &OXVWHULQJ 5HJUHVVLRQ &RPSXWHU DQG +XPDQ LQVSHFWLRQ
,QFRQVLVWHQW'DWD'DWD,QWHJUDWLRQDQG7UDQVIRUPDWLRQ'DWD5HGXFWLRQ'DWD&XEH
$JJUHJDWLRQ 'LPHQVLRQDOLW\ UHGXFWLRQ 'DWD &RPSUHVVLRQ 1XPHURVLW\ 5HGXFWLRQ
&OXVWHULQJ'LVFUHWL]DWLRQDQG&RQFHSWKLHUDUFK\JHQHUDWLRQ
,,
&RQFHSW 'HVFULSWLRQ
'HVFULSWLRQ 'HILQLWLRQ 'DWD *HQHUDOL]DWLRQ $QDO\WLFDO &KDUDFWHUL]DWLRQ
$QDO\VLV RI DWWULEXWH UHOHYDQFH 0LQLQJ &ODVV FRPSDULVRQV 6WDWLVWLFDO PHDVXUHV LQ
ODUJH'DWDEDVHV0HDVXULQJ&HQWUDO7HQGHQF\0HDVXULQJ'LVSHUVLRQRI'DWD*UDSK
'LVSOD\V RI %DVLF 6WDWLVWLFDO FODVV 'HVFULSWLRQ 0LQLQJ $VVRFLDWLRQ 5XOHV LQ /DUJH
'DWDEDVHV$VVRFLDWLRQUXOHPLQLQJPLQLQJ6LQJOH'LPHQVLRQDO%RROHDQ$VVRFLDWLRQ
UXOHV IURP 7UDQVDFWLRQDO 'DWDEDVHV± $SULRUL $OJRULWKP 0LQLQJ 0XOWLOHYHO
$VVRFLDWLRQ UXOHV IURP 7UDQVDFWLRQ 'DWDEDVHV DQG 0LQLQJ 0XOWL 'LPHQVLRQDO
$VVRFLDWLRQUXOHVIURP5HODWLRQDO'DWDEDVHV
,,,
:KDW LV &ODVVLILFDWLRQ 3UHGLFWLRQ ,VVXHV UHJDUGLQJ &ODVVLILFDWLRQ DQG SUHGLFWLRQ
'HFLVLRQWUHH%D\HVLDQ&ODVVLILFDWLRQ&ODVVLILFDWLRQE\%DFNSURSDJDWLRQ0XOWLOD\HU
IHHGIRUZDUG 1HXUDO 1HWZRUN %DFN SURSDJDWLRQ $OJRULWKP &ODVVLILFDWLRQ PHWKRGV
.QHDUHVW QHLJKERXU FODVVLILHUV *HQHWLF $OJRULWKP &OXVWHU $QDO\VLV 'DWD W\SHV LQ
FOXVWHUDQDO\VLV&DWHJRULHVRIFOXVWHULQJPHWKRGV3DUWLWLRQLQJPHWKRGV+LHUDUFKLFDO
&OXVWHULQJ&85(DQG&KDPHOHRQ'HQVLW\%DVHG0HWKRGV'%6&$1237,&6*ULG
%DVHG 0HWKRGV 67,1* &/,48( 0RGHO %DVHG 0HWKRG ±6WDWLVWLFDO $SSURDFK
1HXUDO1HWZRUNDSSURDFK2XWOLHU$QDO\VLV
,9
'DWD :DUHKRXVLQJ
:DUHKRXVLQJ 2YHUYLHZ 'HILQLWLRQ 'HOLYHU\ 3URFHVV 'LIIHUHQFH EHWZHHQ
'DWDEDVH6\VWHPDQG'DWD:DUHKRXVH0XOWL'LPHQVLRQDO'DWD0RGHO'DWD&XEHV
6WDUV 6QRZ )ODNHV )DFW &RQVWHOODWLRQV &RQFHSW KLHUDUFK\ 3URFHVV $UFKLWHFWXUH 7LHU$UFKLWHFWXUH'DWD0LQLQJ
9
$JJUHJDWLRQ +LVWRULFDO LQIRUPDWLRQ 4XHU\ )DFLOLW\ 2/$3 IXQFWLRQ DQG 7RROV
2/$3 6HUYHUV 52/$3 02/$3 +2/$3 'DWD 0LQLQJLQWHUIDFH 6HFXULW\ %DFNXS
DQG5HFRYHU\7XQLQJ'DWD:DUHKRXVH7HVWLQJ'DWD:DUHKRXVH
7H[W%RRNV5HIHUHQFHV
7H[W%RRNV5HIHUHQFHV
'DWD:DUHKRXVLQJLQWKH5HDO:RUOG±$QDKRU\DQG0XUUD\3HDUVRQ(GXFDWLRQ
'DWD0LQLQJ±&RQFHSWVDQG7HFKQLTXHV±-LDZDL+DQDQG0LFKHOLQH.DPEHU
%XLOGLQJWKH'DWD:DUHKRXVH±:+,QPRQ:LOH\
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
7IT4 INTERNET PROGRAMMING (Info. Tech.)
Class: VII Sem. B.Tech.
Evaluation
Branch: Info. Tech
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units
Contents of the subject
I
Introduction , Editing XHTML , First XHTML Example , W3C XHTML Validation
service , Headings, Linking , Images , Special Characters and horizontal rules, Lists,
Tables, forms, Internet linking, web resources. Cascading Style Sheets Introduction ,
Inline Styles, Embedded Style Sheets, Conflicting Styles , Linking External Style Sheets,
Positioning Elements , Backgrounds , Element Dimensions , Box Model and Text Flow
Media types, Building a CSS drop-down menu, User Style Sheets ,CSS3, Web
Resources
II
JavaScript: Introduction to Scripting, Control Structures, Functions, Arrays, Objects, and
Document object model (DOM): Objects and Collections, Events. XML and RSS:
Introduction, XML basics, structuring data, XML namespaces, document type
definitions (DTDs), W3C XML schema documents ,XML vocabularies, Extensible style
sheet language and XSL transformations, Document object model(DOM),RSS
III
Ajax-enabled rich internet applications: introduction , traditional web applications vs
Ajax application , rich internet application (RIAs)with Ajax, history of Ajax, “Raw”
Ajax example using the XMLHttpRequest object , using XML and the DOM, creating a
full-scale Ajax –enabled application ,dojo toolkit Web Servers (IIS and Apache):
introduction, HTTP transactions , multi tier application architecture ,client-side scripting
versus server-side scripting ,accessing web servers, Microsoft internet information
services(IIS), Apache HTTP server, requesting documents.
IV
PHP: Introduction, PHP basics, string processors and regular expressions , form
processing and business logic, connecting to a database, using cookies, dynamic content,
operator precedence chart ASP.NET 2.0 and ASP.NET Ajax: introduction, creating and
running a simple web form example, web controls, session tracking
case study : connecting to a database in ASP.NET
V
Java Server Faces Web applications: introduction, java web technologies, creating and
running a simple application in NetBeans, JSF components , session tracking
References
1. Internet & WWW, How to program, DEITEL P.J., H.M., Prentice Hall
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
7 IT 5 COMPUTER GRAPHICS & MULTIMEDIA TECHNIQUES (Common to Comp. Engg.
& Info. Tech.)
Class: VII Sem. B.Tech.
Evaluation
Branch: Info. Tech
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units
,
,,
Contents of the subject
,QWURGXFWLRQ,QWURGXFWLRQWR5DVWHUVFDQGLVSOD\V6WRUDJHWXEHGLVSOD\VUHIUHVKLQJ
,QWURGXFWLRQ
IOLFNLQJ LQWHUODFLQJ FRORU PRQLWRUV GLVSOD\ SURFHVVRUV UHVROXWLRQ ,QWURGXFWLRQ WR
,QWHUDFWLYH &RPSXWHU *UDSKLFV 3LFWXUH DQDO\VLV2YHUYLHZ RI SURJUDPPHU¶V PRGHO
RILQWHUDFWLYHJUDSKLFV)XQGDPHQWDOSUREOHPVLQJHRPHWU\6FDQ&RQYHUVLRQSRLQW
OLQH FLUFOH HOOLSVH SRO\JRQ $OLDVLQJ DQG LQWURGXFWLRQ WR $QWL $OLDVLQJ 1R DQWL
DOLDVLQJDOJRULWKP
' ' &R
&RRUGLQDWH V\VWHP
V\VWHP +RPRJHQHRXV &RRUGLQDWHV 7UDQVODWLRQ 5RWDWLRQ
6FDOLQJ 5HIOHFWLRQ ,QYHUVH WUDQVIRUPDWLRQ &RPSRVLWH WUDQVIRUPDWLRQ 3RO\JRQ
5HSUHVHQWDWLRQ)ORRG)LOOLQJ%RXQGDU\ILOOLQJ
3RLQW &OLSSLQJ &RKHQ6XWKHUODQG /LQH &OLSSLQJ $OJRULWKP 3RO\JRQ &OLSSLQJ
DOJRULWKPV
,,,
,9
9
+LGGHQ /LQHV 6XUIDFHV
6XUIDFHV ,PDJH DQG 2EMHFW VSDFH 'HSWK %XIIHU 0HWKRGV +LGGHQ
)DFHWVUHPRYDO6FDQOLQHDOJRULWKP$UHDEDVHGDOJRULWKPV
&XUYHVDQG6SOLQHV3DUDPHWULFDQG1RQSDUDPHWULF5HSUHVHQWDWLRQV%H]LHUFXUYH%
&XUYHVDQG6SOLQHV
6SOLQH&XUYHV
5HQGHULQJ
5HQGHULQJ %DVLF LOOXPLQDWLRQ PRGHO GLIIXVH UHIOHFWLRQ VSHFXODU UHIOHFWLRQ SKRQJ
VKDGLQJ*RXUDQGVKDGLQJUD\WUDFLQJFRORUPRGHOVOLNH5*%<,4&0<+69
0XOWLPHGLD
0XOWLPHGLD 0XOWLPHGLD FRPSRQHQWV 0XOWLPHGLD ,QSXW2XWSXW 7HFKQRORJLHV
6WRUDJHDQGUHWULHYDOWHFKQRORJLHV$UFKLWHFWXUDOFRQVLGHUDWLRQVILOHIRUPDWV
$QLPDWLRQ,QWURGXFWLRQ5XOHVSUREOHPVDQG$QLPDWLRQWHFKQLTXHV
$QLPDWLRQ
Text/References:
1. J. Foley, A. Van Dam, S. Feiner, J. Hughes: Computer Graphics- Principles and Practice, Pearson
2. Hearn and Baker: Computer Graphics, PHI
3. Multimedia Systems Design, Prabhat Andleigh and Thakkar, PHI.
4. Multimedia Information Networking, N.K.Sharda, PHI..
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
7IT6.1 ADVANCE DATABASE MANGEMENT SYSTEMS (Common to Comp. Engg. & Info.
Tech.)
Class: VII Sem. B.Tech.
Evaluation
Branch: Info. Tech.
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units
Contents of the subject
4XHU\ 3URFHVVLQJ DQG
2SWLPL]DWLRQ 2YHUYLHZ RI 5HODWLRQDO 4XHU\ 2SWLPL]DWLRQ
DQG 2SWLPL]DWLRQ
6\VWHP
&DWDORJ
LQ
D
5HODWLRQDO
'%06 $OWHUQDWLYH 3ODQV 7UDQVODWLQJ 64/ 4XHULHV
,
LQWR $OJHEUD (VWLPDWLQJ WKH &RVW RI D 3ODQ 5HODWLRQDO $OJHEUD (TXLYDOHQFHV
(QXPHUDWLRQRI$OWHUQDWLYH3ODQV>@
2EMHFW'DWDEDVH6\VWHPV0RWLYDWLQJ([DPSOHV6WUXFWXUHG'DWD7\SHV2SHUDWLRQV
2EMHFW'DWDEDVH6\VWHPV
2Q6WUXFWXUHG'DWD(QFDSVXODWLRQDQG$'7
V,QKHULWDQFH2EMHFWV2,'VDQG
,,
5HIHUHQFH7\SHV'DWDEDVH'HVLJQIRUDQ25'%0625'%06,PSOHPHQWDWLRQ
&KDOOHQJHV25'%06&RPSDULQJ5'%0622'%06DQG25'%06
3DUDOOHO DQG 'LVWULEXWHG 'DWDEDVHV
'DWDEDVHV $UFKLWHFWXUHV IRU 3DUDOOHO 'DWDEDVHV 3DUDOOHO
4XHU\(YDOXDWLRQ3DUDOOHOL]LQJ,QGLYLGXDO2SHUDWLRQV3DUDOOHO4XHU\2SWLPL]DWLRQ
'LVWULEXWHG '%06 $UFKLWHFWXUHV 6WRULQJ 'DWD LQ D 'LVWULEXWHG '%06 'LVWULEXWHG
,,,
&DWDORJ 0DQDJHPHQW 'LVWULEXWHG 4XHU\ 3URFHVVLQJ 8SGDWLQJ 'LVWULEXWHG 'DWD
,QWURGXFWLRQ WR 'LVWULEXWHG 7UDQVDFWLRQV 'LVWULEXWHG &RQFXUUHQF\ &RQWURO
'LVWULEXWHG5HFRYHU\>@
'DWDEDVH 6HFXULW\ DQG $XWKRUL]DWLRQ
$XWKRUL]DWLRQ ,QWURGXFWLRQ WR 'DWDEDVH 6HFXULW\ $FFHVV
&RQWURO 'LVFUHWLRQDU\ $FFHVV &RQWURO *UDQW DQG 5HYRNH RQ 9LHZV DQG ,QWHJULW\
,9
&RQVWUDLQWV 0DQGDWRU\ $FFHVV &RQWURO 0XOWLOHYHO5HODWLRQV DQG 3RO\LQVWDQWLDWLRQ
&RYHUW&KDQQHOV'R'6HFXULW\/HYHOV$GGLWLRQDO,VVXHV5HODWHGWR6HFXULW\5ROHRI
WKH'DWDEDVH$GPLQLVWUDWRU6HFXULW\LQ6WDWLVWLFDO'DWDEDVHV(QFU\SWLRQ>@
3267*(6
3267*(6 3267*5(6 XVHU LQWHUIDFHV VTO YDULDWLRQV DQG H[WHQVLRQV 7UDQVDFWLRQ
0DQDJHPHQW 6WRUDJH DQG ,QGH[LQJ 4XHU\ SURFHVVLQJ DQG RSWLPL]DWLRQV 6\VWHP
$UFKLWHFWXUHV
9
;0/
;0/ 0RWLYDWLRQ 6WUXFWXUH RI ;0/ GDWD ;0/ 'RFXPHQW 6FKHPD 4XHU\LQJ DQG
7UDQVIRUPDWLRQ$SSOLFDWLRQ3URJUDP,QWHUIDFHWR;0/6WRUDJHRI;0/'DWD;0/
DSSOLFDWLRQV>@
Text/References
1. Elmasri R and Navathe SB, Fundamentals of Database Systems, 3rd Edition, Addison Wesley,
2000.
2. Connolly T, Begg C and Strachan A, Database Systems, 2nd Edition, Addison Wesley, 1999
3. Ceri Pelagatti , Distributed Database: Principles and System - (McGraw Hill)
4. Simon AR, Strategic Database Technology: Management for the Year 2000, Morgan Kaufmann,
1995
5. A. Silversatz, H. Korth and S. Sudarsan: Database Cocepts 5th edition, Mc-Graw Hills 2005.
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
7 IT 6.2 INTELLIGENT SYSTEMS (Info. Tech)
Class: VII Sem. B.Tech.
Evaluation
Branch: Info. Tech
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units
Contents of the subject
,
,QWURGXFWLRQ3UREOHPV+HXULVWLF6HDUFK
,QWURGXFWLRQ3UREOHPV+HXULVWLF6HDUFK7KH$,3UREOHPVDQGDVVXPSWLRQ
LF6HDUFK
$,7HFKQLTXH3UREOHP3UREOHPVSDFH3URGXFWLRQ6\VWHPFKDUDFWHULVWLFV
3UREOHPFKDUDFWHULVWLFV+HXULVWLFVVHDUFK7HFKQLTXH
+HXULVWLFVVHDUFK7HFKQLTXH
+HXULVWLFVVHDUFK7HFKQLTXH*HQHUDWHDQGWHVW+LOO
&OLPELQJ %)6 3UREOHP 5HGXFWLRQ FRQVWUDLQW VDWLVIDFWLRQ 0HDQVHQGV
DQDO\VLV
,,
.QRZOHGJH 5HSUHVHQWDWLRQ
5HSUHVHQWDWLRQ 5HSUHVHQWDWLRQ DQG 0DSSLQJ DSSURDFKHV ,VVXH
3UHGLFDWH /RJLF5HSUHVHQWDWLRQ RI 6LPSOH IDFWV LQ ORJLF LQVWDQFH DQG ,6$
UHSUHVHQWDWLRQ FRPSXWDEOH IXQFWLRQV DQG SUHGLFDWHV 5HVROXWLRQ QDWXUDO
GHGXFWLRQ 5HSUHVHQWLQJ .QRZOHGJH 8VLQJ 5XOHV 3URFHGXUDO YV 'HFODUDWLYH
.QRZOHGJH )RUZDUGHG YV %DFNZDUG 5HDVRQLQJ /RJLF 3URJUDPPLQJ DQG
0DWFKLQJ
,,,
*DPH SOD\LQJ
0LQLPD[ 6HDUFK 3URFHGXUH DGGLQJ $OSKD %HWD
SOD\LQJ ,QWURGXFWLRQ
&XWRII DGGLWLRQDO UHILQHPHQWV ,WHUDWLYH 'HHSLQJV UHIHUHQFH RQ VSHFLILF
JDPHV 3ODQQLQJ
3ODQQLQJ &RPSRQHQW RI 3ODQQLQJ 6\VWHP *RDO 6WDFN 3ODQQLQJ
1RQOLQHDU 3ODQQLQJ +LHUDUFKLFDO 3ODQQLQJ DQG 5HDFWLYH 6\VWHP
8QGHUVWDQGLQJ
,9
/HDUQLQJ
/HDUQLQJ,QWURGXFWLRQUROHRIOHDUQLQJOHDUQLQJLQSUREOHPVROYLQJH[DPSOH
DQG H[SODQDWLRQ EDVHG OHDUQLQJ GLVFRYHU\ DQDORJ\ IRUPDO OHDUQLQJ WKHRU\
&RQQHFWLRQLVW PRGHO
PRGHO ,QWURGXFWLRQ WR QHXUDO QHWZRUNV KRSILHOG QHWZRUNV
OHDUQLQJ LQ 1HXUDO 1HWZRUN DSSOLFDWLRQ RI QHXUDO QHWZRUN UHFXUUHQW
QHWZRUN
9
([SHUW V\VWHP
V\VWHP ,QWURGXFWLRQ UHSUHVHQWLQJ XVLQJ GRPDLQ NQRZOHGJH H[SHUW
V\VWHP VKHOO H[SODQDWLRQ DQG NQRZOHGJH DFTXLVLWLRQ )X]]\ /RJLF 6\VWHP
6\VWHP
,QWURGXFWLRQ&ULVS6HWV)X]]\6HWV)X]]\7HUPLQRORJ\)X]]\/RJLF&RQWURO
)X]]\,QIHUHQFH3URFHVVLQJ*HQHWLFDOJRULWKPV
*HQHWLFDOJRULWKPV
*HQHWLFDOJRULWKPV,QWURGXFWLRQVLJQLILFDQFHRI
JHQHWLF RSHUDWRUV WHUPLQDWLRQ SDUDPHWHUV QLFKLQJ VSHFLDWLRQ HYROYLQJ
QHXUDOQHWZRUNV$17DOJRULWKPV
7H[W%RRNV5HIHUHQFHV
$UWLILFLDO,QWHOOLJHQFH(ODLQH5LFK.HYLQ.QLJKW0F*UDZ+LOO
,QWURGXFWLRQWR$,([SHUW6\VWHP'DQ:3DWWHUVRQ3+,
$UWLILFLDO,QWHOOLJHQFHE\/XJHU3HDUVRQ(GXFDWLRQ
5XVVHO1RUYLJ$UWLILFLDO,QWHOOLJHQFH$0RGHUQ$SSURDFK3UHQWLFH+DOO
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
7IT 6.3 SPEECH PROCESSING (Info. Tech)
Class: VII Sem. B.Tech.
Evaluation
Branch: Info. Tech
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units
Contents of the subject
I
The speech chain: current capabilities in synthesis and recognition.
Acoustic phonetics. Vocal tract physiology: voiced excitation, unvoiced
excitation (bursts, frication). Acoustics of uniform tubes, of two- and threetube models. Comparison to speech data.
II
Synthesis: Formant synthesis (series, parallel), Articulatory synthesis,
Concatenative Synthesis, Text-to-Speech (normalisation, linguistic units,
rules). Articulatory parameters, shape-to-sound transformation, vocal tract
imaging, revising the acoustic model.
Letter-sound relations, phonology; prosody, intelligibility, quality
assessment.
III
Ear physiology. Auditory perception. Speech perception.
IV
Recognition: Template matching. (Training, distance measures, dynamic
time warping), Stochastic models. (Hidden Markov models, Baum-Welch
and Forward-Backward algorithms). Large-Vocabulary Recognition.
(Phonemic baseforms, language models), Artificial Neural Networks.
(Overview, hybrid systems).
V
Assessing recognition performance; improving recognition
performance; Knowledge-based approaches, auditory models.
References:
1. J N Holmes and W. Holmes, Speech Synthesis and Recognition, 2nd ed.,
Taylor and Francis, 2001.
2. B. Gold and N. Morgan, Speech and Audio Signal Processing, Wiley and
Sons, 2000.
3. G. Childers, Speech Processing and Synthesis Toolboxes, Wiley and Sons,
2000.
4. J. R. Deller, J. R. Proakis, J. H. L. Hansen, Discrete-Time Processing of
Speech Signals, Prentice-Hall 1993.
5. P. B. Denes and E. N. Pinson, The Speech Chain, W. H. Freeman & Co 1993.
6. S Furui, Digital Speech Processing, Synthesis and Recognition, Marcel
Dekker Inc 1989.
7. D O'Shaughnessy, Speech Communications: Human & Machine, IEEE Press
1999.
8. L R Rabiner and R W Schafer, Digital Processing of Speech Signals,
Prentice-Hall 1978.
9. K. N. Stevens, Acoustic Phonetics, MIT
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
7IT7 COMPUTER GRAPHICS & MULTIMEDIA LAB (Common to Comp. Engg. &
Info. Tech)
1.
2.
3.
4.
5.
6.
7.
Class: VII Sem. B.Tech.
Evaluation
Branch: Info. Tech.
Schedule per Week
Practical Hrs.: 2
Examination Time = Four (4) Hours
Maximum Marks = 50
[Sessional /Mid-term (30) & End-term (20)]
Objectives:
At the end of the semester, the students should have clearly understood and implemented the
following:
To produce a single pixel and pre specified pattern on screen:
To implement features like changing background color, foreground color, resizing of
window, repositioning of window:
To implement mid point algorithm to draw circle and ellipse:
Use the line drawing & circle drawing programs to draw composite objects containing only
circle & lines. You can take shapes like a cart, car etc.
To Implement Clipping (various algorithms).
Simple fonts, graphical fonts, scalable fonts.
Input a polygon by drawing lines, use appropriate methods for filling and filling convex &
concave polygons.
Suggested Platform/Tools:
1. For this lab, the students can choose any platform either Microsoft Windows or Linux.
2. Compilers & Libraries: Microsoft Platform- Visual Studio.Net, Linux – Xlib.
3. No turbo C/C++. No library function except the one required to put a single pixel on the screen.
Indicative List of Experiments:
1. Programs to produce a single pixel produce a pre specified pattern with features like changing
background color, foreground color, resizing of window, repositioning of window must be
demonstrated.
2. Use Mid Point algorithm to draw line between two points. The program must be independent of the
slope i.e. lines of all slopes must be drawn.
3. Use Mid Point algorithm to draw ellipse. Implement circle drawing as a special case of ellipse. Extend
this to draw arcs between points.
4. Programs to draw composite objects containing circles & lines, drawing lines thicker than one pixel,
you can take shapes like a cart, car etc.
5. Programs to demonstrate text generation e.g. simple fonts, graphical fonts, and scalable fonts.
6. Programs to demonstrate filling algorithms eg. filling convex & concave polynomials. The program
must be able to (i) input a polynomial by drawing lines (ii) determine whether convex or concave (iii)
use appropriate methods for filling.
7. Programs to demonstrate clipping algorithms eg. program to clip a (i) line and (ii) polygon using
Cohen-Sutherland Clipping algorithm(s), clipping lines, circles against a rectangular clip area.
8. Programs to demonstrate presentation of geometrical objects e.g.circle and rectangle with audio
description i.e. size, color of boundary and interior etc. played synchronously one after another.
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
7 IT 8 UML Lab (Info. Tech)
Class: VII Sem. B.Tech.
Evaluation
Branch: Info.Tech.
Schedule per Week
Practical Hrs : 3
Objectives:
Examination Time = Four (4) Hours
Maximum Marks = 100
[Sessional/Mid-term (60) & End-term (40)]
1. The students shall be able to use following modules of UML for system
description, implementation and finally for product development.
-
-
-
Capture a business process model.
The User Interaction or Use Case Model - describes the boundary and
interaction between the system and users. Corresponds in some respects
to a requirements model.
The Interaction or Communication Model - describes how objects in the
system will interact with each other to get work done.
The State or Dynamic Model - State charts describe the states or
conditions that classes assume over time. Activity graphs describe the
workflows the system will implement.
The Logical or Class Model - describes the classes and objects that will
make up the system.
The Physical Component Model - describes the software (and sometimes
hardware components) that make up the system.
The Physical Deployment Model - describes the physical architecture and
the deployment of components on that hardware architecture.
The students are expected to use the UML models, prepare necessary documents
using UML and implement a system. Some hardware products like digital clock,
digital camera, washing machine controller, air conditioner controller, an electronic
fan regulator, an elementary mobile phone etc. may also be chosen.
The students shall be assigned one problem on software based systems and
another involving software as well as hardware.
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
7 IT 9 INTERNET PROGRAMMING LAB (Info. Tech)
Class: VII Sem. B.Tech.
1.
2.
3.
4.
5.
6.
Evaluation
Examination Time = Four (4) Hours
Branch: Info. Tech.
Maximum Marks = 50
Schedule per Week
[Sessional/Mid-term (30) & End-term (20)]
Practical Hrs : 2
Objectives: At the end of the semester, the students should have clearly understood and
implemented the following:
Develop basic understanding of HTML script: overview of HTML, basic HTML tags, title,
head and body.
Write web pages in HTML: formatting text in HTML, inserting photographs on the page,
drawing tables, creating hyperlinks-internal and external, creating hyperlinks of external
web sites.
Develop understanding of creating standard view of web site: displaying multiple pages
over a single page, displaying it as standard view like header and footer, creating standard
text formatting over the web site.
Develop understanding common formation over a web site: creating and using css,
understanding importance of common text formatting over a website.
Develop understanding of server side scripting language: basic concepts of scripting
language, client side and server side scripting, introduction to php, variable, control
statements, loops .
Develop applications using php and MySQL: using php to access database, mysql database
selection, create, update and delete script in php.
It is expected that each laboratory assignments to given to the students with an aim to In
order to achieve the above objectives
Indicative List of Experiments:
1. Develop a static html page using style sheet to show your own profile. Add pages one by one
to show 5 photos, to show your academics in tabular format, a page containing 5 links to your
favorite website, navigational links to all above pages (menu), header, footer, left-sidebar, right
sidebar etc.
2. Use Cascading Style Sheets to format your all pages in a common format.
3. Write a simple "hello word" program using php.
4. Write a program to accept two strings (name and age) from user. Print welcome statement e.g.
“Hi Ram, your age is 24."
5. Write a program to create a calculator, which can support addition, subtraction, multiply and
division operations.
6. Write a program to take input parameters for a table (no. of rows and no. of columns) and
create the desired table.
7. Create a "Contact Me" page -Ask user to enter his name, email ID, Use Java-Script to verify
entered email address. Store submitted value in a MySql database. Display latest 5 submitted
records in contact me page. Display above record with navigation support. e.g. (next, previous,
first, last)
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
8 IT 1 SOFTWARE TESTING & VALIDATION (Info. Tech)
Class: VIII Sem. B.Tech.
Evaluation
Branch: Info. Tech
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units
Contents of the subject
,
6RIWZDUH 9HULILFDWLRQ DQG 9DOLGDWLRQ
9DOLGDWLRQ ,QWURGXFWLRQ 9HULILFDWLRQ 0HWKRG RI
9HULILFDWLRQ 9DOLGDWLRQ /HYHO RI 9DOLGDWLRQ 3ULQFLSOH RI WHVWLQJ FRQWH[W RI
WHVWLQJ LQ SURGXFLQJ VRIWZDUH :KLWH %R[ WHVWLQJ 'HILQLWLRQ 6WDWLF WHVWLQJ
6WUXFWXUDOWHVWLQJ%ODFNER[WHVWLQJ
,,
,QWHJUDWLRQ 7HVWLQJ
7HVWLQJ 6FHQDULR 7HVWLQJ 'HIHFW EDVK 6\VWHP DQG DFFHSWDQFH
WHVWLQJ IXQFWLRQDO QRQIXQFWLRQDO WHVWLQJ 3HUIRUPDQFH WHVWLQJ
PHWKRGRORJ\WRROV3URFHVV
,,,
5HJUHVVLRQ7HVWLQJ,QWHUQDWLRQDOL]DWLRQ7HVWLQJ,QWURGXFWLRQ
7HVW 3KDVHV RI
5HJUHVVLRQ7HVWLQJ,QWHUQDWLRQDOL]DWLRQ7HVWLQJ
,QWHUQDWLRQDOL]DWLRQ WHVWLQJ (QDEOLQJ WHVWLQJ /RFDOH 7HVWLQJ /DQJXDJH
WHVWLQJ /RFDOL]DWLRQ WHVWLQJ $GKRF WHVWLQJ 2YHUYLHZ %XGG\ WHVWLQJ 3DLU
7HVWLQJ([SORUDWRU\7HVWLQJ,WHUDWLYHWHVWLQJ$JLOHDQG([WUHPH7HVWLQJ
7HVWLQJ2I2EMHFWRULHQWHGV\VWHPV
7HVWLQJ2I2EMHFW RULHQWHGV\VWHPV,QWURGXFWLRQ3ULPHURQREMHFW±RULHQWHG
RULHQWHGV\VWHPV
VRIWZDUH'LIIHUHQFHVLQ22WHVWLQJ
,9
9
8VDELOLW\ $QG $FFHVVLELOLW\ 7HVWLQJ
7HVWLQJ ZKDW LV XVDELOLW\ WHVWLQJ DSSURDFK WR
XVDELOLW\ ZKHQ WR GR XVDELOLW\ WHVWLQJ KRZ WR DFKLHYH XVDELOLW\ TXDOLW\
IDFWRUVIRUXVDELOLW\DFFHVVLELOLW\WHVWLQJWRROVIRUXVDELOLW\
7HVW SODQQLQJ 7HVW 0DQDJHPHQW 7HVW 3URFHVV DQG UHSRUWLQJ 6RIWZDUH 7HVW
$XWRPDWLRQ 6FRSH RI $XWRPDWLRQ 'HVLJQ DQG $UFKLWHFWXUH RI DXWRPDWLRQ
3URFHVV 0RGHO IRU $XWRPDWLRQ 7HVW PDWULFHV DQG PHDVXUHPHQW 7\SH RI
0HWULFV 3URMHFW 0HWULFV 3URGXFWLYLW\ 0HWULFV 3URJUHVV 0HWULFV 5HOHDVH
0HWULFV
7H[W%RRNV5HIHUHQFHV
6RIWZDUHWHVWLQJ6ULQLYDVDQ'*RSDOVZDPL53HDUVRQ(GXFDWLRQ
6RIWZDUH7HVWLQJ0*/LPD\H70+
6RIWZDUH(QJLQHHULQJ6RPPHUYLOOH3HDUVRQ(GXFDWLRQ
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
8 IT 2 INFORMATION SYSTEM SECURITY (Common to Comp. Engg. & Info. Tech)
Class: VIII Sem. B.Tech.
Evaluation
Branch: Info. Tech.
Schedule per Week
Lectures: 3
Units
Contents of the subject
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Elements of Number Theory: Divisibility and Euclid Algorithm, Primes and the Sieve of
Eratosthenes, testing for primes, Prime Number Theorem, Euler’s, Fermat’s Little
theorems, Congruences, Computing Inverse in Congruences, Legendre and Jacobi
Symbols, Chinese Remainder Theorem,
I
Algebraic Structures in Computing (Definitions, properties and Elementary Operations
Only): Groups, subgroup, order of group, cyclic group, ring, field, division algorithm,
polynomial over a field. Galois Field
Elements of Information Theory: Entropy, redundancy of language, Key Equivocation &
Unicity Distance, equivocation of a simple cryptographic system
Security Attacks: Active V/S Passive, Security Services, Security Mechanisms.
Symmetric Cipher Model, Types of attacks on Encrypted messages.
Classical Cipher Techniques: Caeser, Affine, Mono-alphabetic, Transposition, Polyalphabetic Ciphers
Private Key Cryptosystems: Block Cipher Principles, Fiestel Cipher, Concept of
II
‘Confusion’ and “Diffusion’ in block ciphers, Product Ciphers, Lucifer Algorithm.
DES Algorithm, DES modes of operations, IDEA.
Differential & Linear Cryptanalysis (Introduction Only).
S-box theory: Boolean Function, S-box design criteria, Bent functions, Propagation and
nonlinearity, construction of balanced functions, S-box design.
Link Vis End-to-End Encryption, Key Distribution in Symmetric Encryption
Public Key Cryptosystems: Principles of Public Key Cryptosystems, Factorization, RSA
Algorithm, security analysis of RSA, Exponentiation in Modular Arithmetic.
III
Key Management in Public Key Cryptosystems: Distribution of Public Keys,
Distribution of Secret keys using Public Key Cryptosystems. Discrete Logarithms,
Diffie-Hellman Key Exchange.
Message Authentication & Hashing: Birthday Paradox and General case of Duplications,
Basic functions of Message Authentication and Hashing, Introduction to Hash & MAC
algorithms.
Digital Signatures: RSA Based, ElGamal Signatures, Undeniable Signatures.
IV
Authentication: Model of Authentication Systems, Impersonation, Substitution and
spoofing games, Authentication schemes for mutual authentication based on shared
secret, two-way public key, one-way public key, Mediated Authentication, One way
Authentication.
X.509 Authentication Service: Certificates, Authentication Procedure, X.509 Version 3.
E-Mail Security: PGP including management of keys in PGP, S/MIME.
Network Security: IPSec, AH & ESP in Transport and Tunnel mode with multiple
V
security associations (Key Management not Included). SSL (Protocols Only)
Intrusion Detection: Audit Reports, Statistical Anomaly Detection, Rule based detection,
honeypots, intrusion detection exchange formats.
Password Protection: Lamport Hash, EKE Protocol.
Text/References:
1. Stalling Williams: Cryptography and Network Security: Principles and Practices, 4th Edition,
Pearson Education, 2006.
2. Kaufman Charlie et.al; Network Security: Private Communication in a Public World, 2nd Ed.,
PHI/Pearson.
3. Pieprzyk Josef and et.al; Fundamentals of Computer Security, Springer-Verlag, 2008.
4. Trappe & Washington, Introduction to Cryptography, 2nd Ed. Pearson.
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
8 IT 3 Data Compression Techniques (Info. Tech)
Class: VIII Sem. B.Tech.
Evaluation
Branch: Info. Tech
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units
Contents of the subject
Compression Techniques: Lossless, lossy, measure of performance, modeling & coding.
I
Lossless compression: Derivation of average information, data models, uniquely
decodable codes with tests, prefix codes, Kraft-Mc Millan inequality.
Huffman coding: Algorithms, minimum variance Huffman codes, optimality, length
extended codes, adaptive coding, Rice codes, using Huffman codes for lossless image
compression.
Arithmetic coding with application to lossless compression.
II
Dictionary Techniques: LZ77, LZ78, LZW
Predictive coding: Burrows-Wheeler Transform and move-to-front coding, JPEG-LS
Facsimile Encoding: Run length, T.4 and T.6
Lossy coding- Mathematical preliminaries: Distortion criteria, conditional entropy,
average mutual information, differential entropy, rate distortion theory, probability and
linear system models.
III
Scalar quantization: The quantization problem, uniform quantizer, Forward adaptive
quantization, non-uniform quantization-Formal adopting quantization,
companded Quantization
Vector quantization: Introduction, advantages, The Linde-Ruzo-Grey algorithm, lattice
vector quantization.
IV
V
Differential encoding – Introduction, Basic algorithm, Adaptive DPCM, Delta
modulation, speech and image coding using delta modulation.
Sampling in frequency and time domain, z-transform, DCT, DST, DWHT, quantization
and coding of transform coefficient.
Sub band coding: Introduction, Filters, Basic algorithm, Design of Filter banks, G.722,
MPEG. Wavelet based compression: Introduction, wavelets multi-resolution analysis
and the scaling function implementation using filters.
References:
1. Sayood K: Introduction to Data Compression: ELSEVIER 2005.
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
8 IT 4.1 MOBILE COMPUTING (Info. Tech)
Class: VIII Sem. B.Tech.
Evaluation
Branch: Info. Tech
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units
,
Contents of the subject
0RELOH FRPSXWLQJ
FRPSXWLQJ 'HILQLWLRQV DGDSWDELOLW\ LVVXHV WUDQVSDUHQF\ (QYLURQPHQWDO
&RQVWUDLQWVDSSOLFDWLRQDZDUHDGDSWDWLRQPHFKDQLVPVIRUDGDSWDWLRQDQGLQFRUSRUDWLQJ
DGDSWDWLRQV
0RELOLW\ PDQDJHPHQW
PDQDJHPHQW PRELOLW\ PDQDJHPHQW ORFDWLRQ PDQDJHPHQW SULQFLSOH DQG
WHFKQLTXHV (QHUJ\ HIILFLHQW QHWZRUN SURWRFROV 3&6 ORFDWLRQ PDQDJHPHQW 6FKHPH
(QHUJ\HIILFLHQWLQGH[LQJRQDLUDQGDOJRULWKP
'DWD GLVVHPLQDWLRQ DQG PDQDJHPHQW FKDOOHQJHV 'DWD GLVVHPLQDWLRQ EDQGZLGWK
DOORFDWLRQIRUSXEOLVKLQJEURDGFDVWGLVNVFKHGXOLQJPRELOHFDFKHPDLQWHQDQFHVFKHPHV
0RELOH:HE&DFKLQJ
,,
,QWURGXFWLRQ WR PRELOH PLGGOHZDUH 0LGGOHZDUH IRU DSSOLFDWLRQ GHYHORSPHQW
DGDSWDWLRQ 0RELOH$JHQWVLQWURGXFWLRQPRELOHDJHQWFRPSXWLQJ PRGHO WHFKQRORJLHV
DSSOLFDWLRQ WR '%06 0RELOH $JHQW 6HFXULW\ DQG )DXOW 7ROHUDQFH XVLQJ 'LVWULEXWHG
7UDQVDFWLRQV5HOLDEOH$JHQW7UDQVIHU$UFKLWHFWXUHRID6HFXUH$JHQW6\VWHP1HWZRUN
6HFXULW\7HVWLQJ8VLQJ0RELOH$JHQWV1HWZRUN6HFXULW\7HVWLQJ8VLQJ0RELOH$JHQWV
,,,
6HUYLFH 'LVFRYHU\ 0LGGOHZDUH
0LGGOHZDUH 6HUYLFH 'LVFRYHU\ VWDQGDUGL]DWLRQ 0HWKRGV
8QLYHUVDOO\ 8QLTXH ,GHQWLILHUV 7H[WXDO 'HVFULSWLRQ XVLQJ LQWHUIDFHV XQLFDVW
'LVFRYHU\ 0XOWLFDVW 'LVFRYHU\ DGYHUWLVHPHQW VHUYLFH FDWDORJV *DUEDJH &ROOHFWLRQ
(YHQWLQJVHFXULW\8QLYHUVDO3OXJDQG3OD\-LQL6DOXWDWLRQ
,9
3HUYDVLYH FRPSXWLQJ
FRPSXWLQJ ,QWURGXFWLRQ 3ULQFLSOHV±'HFHQWUDOL]DWLRQ 'LYHUVLILFDWLRQ
&RQQHFWLYLW\ 6LPSOLFLW\ 3HUYDVLYH ,QIRUPDWLRQ 7HFKQRORJ\ 0RELOH 'HYLFHV ±
&ODVVLILFDWLRQ &KDUDFWHULVWLFV /LPLWDWLRQV 6PDUW ,GHQWLILFDWLRQ ± 6PDUW &DUG 6PDUW
/DEHO6PDUW7RNHQV6PDUW6HQVRUVDQG$FWXDWRUV6PDUW+RPH
9
:HE 6HUYLFHV :HE 6HUYLFH $UFKLWHFWXUH :6'/ 8'', 62$3 :HE 6HUYLFH 6HFXULW\
:HE 6HUYLFHV IRU 5HPRWH 3RUWDOV ,QWHUQHW 3RUWDOV ± )XQFWLRQDO 2YHUYLHZ 7\SH ± %(
3RUWDOV3RUWDO,QIUDVWUXFWXUH
6WDQGDUGV'(&77(75$8076,07,U'$$UFKLWHFWXUHSURWRFROVWDFNV
6WDQGDUGV
References:
1. Frank Adelstein, Sandeep Gupta, Golden Richard III, Loren Schwiebert, Fundamentals of
Mobile and Pervasive Computing, TMH.
2. Principles of mobile computing Hansmann & Merk., Springer
3. Mobile communications Jochen Schiller , Pearson
4. 802.11 wireless networks Matthew S.Gast, O’REILLY.
5. Wireless LANs: Davis & McGuffin, McGraw Hill
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
8 IT 4.2 Network Management (Info. Tech)
Class: VIII Sem. B.Tech.
Branch: Info. Tech
Schedule per Week
Lectures: 3
Evaluation
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
8QLWV
8QLWV
&RQWHQWVRIWKHVXEMHFW
&RQWHQWVRIWKHVXEMHFW
,
)RXQGDWLRQ
)RXQGDWLRQ RI SROLF\ PDQDJHPHQW
PDQDJHPHQW LQWURGXFWLRQ GHILQLWLRQ RI SROLF\
PDQDJHPHQW PRWLYDWLRQ IRU SROLF\ PDQDJHPHQW QHHG IRU D QHZ VKDUHG
LQIRUPDWLRQPRGHOEHQHILWVRI3%10
3ROLF\ 0DQDJHPHQW )XQGDPHQWDOV 7KH QHHG IRU REMHFWRULHQWHG DQDO\VLV
GHVLJQDQGPRGHOLQJLQ3%10V\VWHPV&RQFHSWXDOSROLF\PRGHO 'HILQLWLRQRI
3%10V\VWHP3ROLF\WHUPLQRORJ\(VVHQWLDOWHUPLQRORJ\IRU3%0 V\VWHPQHZ
WHUPLQRORJ\ QRW FRYHUHG LQ 5)& 'HILQLWLRQ RI SROLF\EDVHG PDQDJHPHQW QHWZRUNPDQDJHPHQW
,,
3ROLF\0DQDJHPHQWDQGWKH6KDULQJRI'DWDLQWURGXFWLRQ7KHQHHGWRH[SUHVV
3ROLF\0DQDJHPHQWDQGWKH6KDULQJRI'DWD
LQIRUPDWLRQLQDFRPPRQZD\+RZWRVROYHFXUUHQWLQVKDULQJDQGUHXVLQJGDWD
([LVWLQJ DSSURDFKHV WR VKDULQJ LQIRUPDWLRQ +RZ WR H[SUHVV LQIRUPDWLRQ LQ D
FRPPRQZD\7KHQHZ'(1QJDSSURDFK
,,,
3ROLF\ 2SHUDWLRQ LQ D 3%10 6\VWHP 3ROLF\ FRPPXQLFDWLRQ *HQHUDO
PDQDJHPHQWLVVXHV3ROLF\RSHUDWLRQ0XVLQJVRQLPSOHPHQWDWLRQ
,9
5HSUHVHQWLQJ+LJK
5HSUHVHQWLQJ+LJK/HYHO3ROLFLHV
/HYHO3ROLFLHV,QWURGXFWLRQ+LJKOHYHOSROLF\VSHFLILFDWLRQ
ROLFLHV
%DVLF SROLFLHV IRU VSHFLI\LQJ EXVLQHVVGULYHQ EHKDYLRU '(1QJ DGGLWLRQV WR WKH
SRQGHU IUDPHZRUN RI EDVLF &RPSRVLWH SROLFLHV 8VH RI KLJKOHYHO SROLFLHV
H[DPSOH
9
&RPSRQHQWV RI 3%10 5HTXLUHPHQWV RI 'LIIHUHQW 3ROLFLHV /LIH RI D 3ROLF\
%XLOGLQJ%ORFNVRI3%10$UFKLWHFWXUHRI3%10
References:
6WUDVVQHU3ROLF\%DVHG1HWZRUN0DQDJHPHQW6ROXWLRQVIRUWKH1H[W*HQHUDWLRQ
(/6(9,(5
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
8 IT 4.3 DIGITAL IMAGE PROCESSING (Common to Comp. Engg. & Info. Tech)
Class: VIII Sem. B.Tech.
Evaluation
Branch: Info. Tech
Schedule per Week
Lectures: 3
Examination Time = Three (3) Hours
Maximum Marks = 100
[Mid-term (20) & End-term (80)]
Units
I
II
III
IV
V
Contents of the subject
Image Representation, Two-Dimensional Systems, Two-Dimensional Fourier
Transform, Image Stochastic Characterization, Psychophysical Vision Properties, Light
Perception, Eye Physiology, Visual Phenomena, Monochrome Vision Model, Color
Vision Model, photometry.
Image Sampling and Reconstruction Concepts, Image Sampling Systems, Image
Reconstruction Systems, Discrete Image Mathematical Representation, Vector-Space
Image Representation, Generalized Two-Dimensional Linear Operator, Image Statistical
Characterization, Image Probability Density Models, Linear Operator Statistical
Representation, Image Quantization, Scalar Quantization, Processing Quantized
Variables, Monochrome Image Quantization.
Superposition and Convolution: Finite-Area Superposition and Convolution, Sampled
Image Superposition and Convolution, Superposition and Convolution Operator
Relationships, 8 Unitary Transforms, General Unitary Transforms, Fourier Transform,
Cosine, Sine, and Hartley Transforms, Hadamard, Haar, Linear Processing Techniques,
Transform Domain Processing, Transform Domain Superposition.
IMAGE IMPROVEMENT: Image Enhancement, Contrast Manipulation, Histogram
Modification, Noise Cleaning, Edge Crispening, Image Restoration Models, General
Image Restoration Models, Optical Systems Models, Photographic Process Models,
Discrete Image Restoration Models, Point and Spatial Image Restoration Techniques,
Sensor and Display Point Nonlinearity Correction, Continuous Image Spatial Filtering
Restoration, Statistical Estimation Spatial Image Restoration, Geometrical Image
Modification, Translation, Minification, Magnification, and Rotation, Perspective
Transformation, Camera Imaging Model,
Morphological Image Processing, Binary Image Connectivity, 6 Gray Scale Image
Morphological Operations, Edge Detection, Edge, Line, and Spot Models, First-Order
Derivative Edge Detection, Second-Order Derivative Edge Detection, Image Feature
Extraction: Image Feature Evaluation, Amplitude Features, Transform Coefficient
Features, Texture Definition, Image Segmentation , Amplitude Segmentation Methods,
Clustering Segmentation Methods,
Region Segmentation Methods,
Boundary
Detection,
References
1. DIGITAL IMAGE PROCESSING: PIKS Inside, Third Edition, WILLIAM K. PRATT, PixelSoft,
Inc., Los Altos, California, ISBN: 9780471374077
2. Anil Jain: Digital Image Processing,
3. Gonzalez Woods: Image Processing
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
8 IT 5 Software Testing Lab. (Info. Tech)
Class: VIII Sem. B.Tech.
Evaluation
Branch: Info.Tech.
Schedule per Week
Practical Hrs.: 3
Examination Time = Four (4) Hours
Maximum Marks = 75
[Sessional/Mid-term (60) & End-term (40)]
S. No.
List of Experiments
1
+DQGVRQ6RIWZDUH(QJLQHHULQJSULQFLSOHV,QIUDVWUXFWXUH
XVDJHRI)URQWHQGDQG%DFNHQGWHFKQRORJLHVDQGSDFNDJHV
2.
3UHSDUHWKHIROORZLQJGRFXPHQWVIRUWKUHHRIWKHH[SHULPHQWVOLVWHGEHORZ
XVLQJVRIWZDUHHQJLQHHULQJPHWKRGRORJ\
3URJUDP$QDO\VLVDQG3URMHFW3ODQQLQJ
7KRURXJKVWXG\RIWKHSUREOHP±,GHQWLI\SURMHFWVFRSH2EMHFWLYHV
3
6RIWZDUHUHTXLUHPHQW$QDO\VLV
'HVFULEHWKHLQGLYLGXDO3KDVHV0RGXOHVRIWKHSURMHFW,GHQWLI\GHOLYHUDEOHV
6RIWZDUH'HVLJQ
D8VHZRUNSURGXFWV±'DWDGLFWLRQDU\8VHFDVHGLDJUDPVDQGDFWLYLW\
GLDJUDPV
4
EXLOGDQGWHVWFODVVGLDJUDPV
E6HTXHQFHGLDJUDPVDQGDGGLQWHUIDFHWRFODVVGLDJUDPV')'(5GLDJUDPV
F6RIWZDUH'HYHORSPHQWDQG'HEXJJLQJXVLQJDQ\)URQWHQGDQG%DFNHQG
WRRO
G6RIWZDUH9HULILFDWLRQDQG9DOLGDWLRQSURFHGXUHV
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
8IT6 DATA COMPRESSION LAB (Info. Tech)
Class: VIII Sem. B.Tech.
Evaluation
Branch: Info.Tech.
Schedule per Week
Practical Hrs : 3
Examination Time = Four (4) Hours
Maximum Marks = 75
[Sessional/Mid-term (60) & End-term (40)]
S. No.
List of Experiments
1
&RPSUHVVDILOHELWPDSIRUPDWKDYLQJVRPHGLDJUDPLQLW7UDQVIHUWKHILOHWR
DQRWKHUV\VWHPGHFRPSUHVVWRGLVSOD\WKHRULJLQDOILOH
2
&RPSUHVVDQDXGLRILOH7UDQVIHUWKHILOHWRDQRWKHUV\VWHPGHFRPSUHVVWR
GLVSOD\WKHRULJLQDOILOH
3
&RPSUHVVDYLGHRILOH7UDQVIHUWKHILOHWRDQRWKHUV\VWHPGHFRPSUHVVWR
GLVSOD\WKHRULJLQDOILOH
4
,PSOHPHQW+XIIPDQFRGLQJZLWKPLQLPXPYDULDQFHRSWLPDOQRQELQDU\
H[WHQGHGDGDSWLYH
5
,PSOHPHQW$SSOLFDWLRQVDQGOLPLWDWLRQVRI+XIIPDQFRGHV5XQOHQJWK
HQFRGLQJ$ULWKPHWLFFRGLQJ3UHGLFWLYHFRGLQJ
,PSOHPHQW/RVV\&RPSUHVVLRQ7HFKQLTXHV±-3(*DQGLWVDSSOLFDWLRQ
6
(UURUGHWHFWLRQDQGFRUUHFWLRQ3DULW\QGLPHQVLRQV+DPPLQJ
FRGHVSRXWRITFRGHV
7
,PSOHPHQW'LFWLRQDU\EDVHGFRPSUHVVLRQ/HPSHO=LY:HOFK/=DQG/=
4XDQWL]DWLRQ±6FDODUDQG9HFWRU4XDQLWL]DWLRQ
8
,PSOHPHQW6KDQQRQ)DQR$OJRULWKP
8IT7: Data Mining & Ware Housing
0L+2P
MM:50
Lab Exercises
EXPERIMENT-1
To perform various commands given in PL/SQL in Oracle 8.0(For brushing up.)
EXPERIMENT-2
To perform multi-dimensional data model using SQL queries. E.g. Star, snowflake and
Fact constellation schemas
EXPERIMENT-3
To perform various OLAP operations such slice, dice, roll up, drill up, pivot etc͘
EXPERIMENT-4
To perform the text mining on the given data warehouse
EXPERIMENT-5
To perform the correlation ship analysis between for the given data set.
EXPERIMENT-6
To perform the attribute relevance analysis on the given data.
EXPERIMENT-7
To perform the information gain for a particular attribute in the given data.
EXPERIMENT-8
To perform the experiment to predict the class using the Bayesian classification
EXPERIMENT-9
Write a program to find out a weight or bias updating using the back propagation in
Neural Network
EXPERIMENT-10
To perform various data mining algorithms on the give data base using
Clementine
Final 21.07.2010
RAJASTHAN TECHNICAL UNIVERSITY
Detailed Syllabus B.Tech. (Info. Tech.) VII & VIII Sem. 2011-12 onwards
8IT8 Seminar on Information Technology Acts (Common to Comp. Engg. & Info. Tech)
Class: VIII Sem. B.Tech.
Evaluation
Branch: Info. Tech.
Schedule per Week
Practical Hrs : 2
Examination Time = Four (2) Hours
Maximum Marks = 50
[Sessional/Mid-term (30) & End-term (20)]
Course Objectives:
1. Study the acts dealing with the cyber crimes in different countries viz., India, USA, European
Union.
2. Study the Intellectual Property Rights and the acts dealing with these rights.
3. Study the Copyright acts with reference to publishing the material on the web.
Students are expected to prepare reports on:
•
Various acts dealing with cyber crimes in the countries.
•
What constitutes a cyber crime in the country?
•
Definitions of electronic documents, evidences, the approved algorithms etc.
•
Investigation methods.
•
Intellectual Property, rights of the creator of the property and legal framework dealing with
these rights.
•
Similarly on Copyright acts.
Further, every student is required to deliver a seminar on a case study involving cyber crimes/
Intellectual Property, Copyright acts. The seminar shall focus on the “methodology and tools used in
the investigation, and enforcement of the applicable acts.”. The seminar may also be presented on new
ways of committing cyber crimes particularly Phishing, botnet etc.
The corresponding acts are the reference material.
Fly UP